CK740330

Overview
NameCK740330
Unique NameCK740330
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2799 contig Csv1_Contig2799:2..639. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_HUMAN (Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens GN=EIF5A2 PE=1 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 2.407e-43
Identity = 84/142 (59.15%), Postives = 110/142 (77.46%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS TYP Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R DYQLI I +DG++SLLTE G  ++DL+LP  E L  +++  +  G+D+ ++VM +M EE   A+K
Sbjct:   11 DAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGE-LGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIK 150          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_CHICK (Eukaryotic translation initiation factor 5A-2 OS=Gallus gallus GN=EIF5A2 PE=1 SV=3)

HSP 1 Score: 174.096 bits (440), Expect = 5.362e-43
Identity = 83/142 (58.45%), Postives = 111/142 (78.17%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS TYP Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R DYQLI I +DG++SLLTE+G  ++DL+LP  + L  +++  F   +D+ ++V+S+M EE   A+K
Sbjct:   11 DAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFNGKKYEDICPSTHNMDVPNIKRNDYQLIGI-QDGYLSLLTESGEVREDLKLPEGD-LGKEIEGKFNANEDVQISVISAMNEECAVAIK 150          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_RABIT (Eukaryotic translation initiation factor 5A-1 OS=Oryctolagus cuniculus GN=EIF5A PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 2.038e-42
Identity = 80/142 (56.34%), Postives = 112/142 (78.87%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS T+P Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R D+QLI I +DG++SLL ++G  ++DLRLP  + L  +++  +  G+++++TV+S+M EE   A+K
Sbjct:   11 DAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGI-QDGYLSLLQDSGEVREDLRLPEGD-LGKEIEQKYDSGEEILITVLSAMTEEAAVAIK 150          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_RAT (Eukaryotic translation initiation factor 5A-1 OS=Rattus norvegicus GN=Eif5a PE=1 SV=3)

HSP 1 Score: 170.629 bits (431), Expect = 5.928e-42
Identity = 80/142 (56.34%), Postives = 112/142 (78.87%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS T+P Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R D+QLI I +DG++SLL ++G  ++DLRLP  + L  +++  +  G+++++TV+S+M EE   A+K
Sbjct:   11 DAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGI-QDGYLSLLQDSGEVREDLRLPEGD-LGKEIEQKYDCGEEILITVLSAMTEEAAVAIK 150          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_MOUSE (Eukaryotic translation initiation factor 5A-1 OS=Mus musculus GN=Eif5a PE=1 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 5.928e-42
Identity = 80/142 (56.34%), Postives = 112/142 (78.87%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS T+P Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R D+QLI I +DG++SLL ++G  ++DLRLP  + L  +++  +  G+++++TV+S+M EE   A+K
Sbjct:   11 DAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGI-QDGYLSLLQDSGEVREDLRLPEGD-LGKEIEQKYDCGEEILITVLSAMTEEAAVAIK 150          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_HUMAN (Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens GN=EIF5A PE=1 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 5.928e-42
Identity = 80/142 (56.34%), Postives = 112/142 (78.87%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS T+P Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R D+QLI I +DG++SLL ++G  ++DLRLP  + L  +++  +  G+++++TV+S+M EE   A+K
Sbjct:   11 DAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGI-QDGYLSLLQDSGEVREDLRLPEGD-LGKEIEQKYDCGEEILITVLSAMTEEAAVAIK 150          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_BOVIN (Eukaryotic translation initiation factor 5A-1 OS=Bos taurus GN=EIF5A PE=2 SV=3)

HSP 1 Score: 170.629 bits (431), Expect = 5.928e-42
Identity = 80/142 (56.34%), Postives = 112/142 (78.87%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS T+P Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R D+QLI I +DG++SLL ++G  ++DLRLP  + L  +++  +  G+++++TV+S+M EE   A+K
Sbjct:   11 DAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGI-QDGYLSLLQDSGEVREDLRLPEGD-LGKEIEQKYDCGEEILITVLSAMTEEAAVAIK 150          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_NEUCR (Eukaryotic translation initiation factor 5A OS=Neurospora crassa GN=tif-51 PE=2 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 4.248e-40
Identity = 84/158 (53.16%), Postives = 109/158 (68.99%), Query Frame = 1
Query:   88 SDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            +  EH F+S  DAGAS TYP Q   +RK G++VIK RPCK+V++STSKTGKHGHAK H V IDIF+GKKLED+ PS+HN DVP+V RTDYQ   I ED F+ L+  NG  K D+++P  E L  +++    EGKD  + V ++MGEE    +K+   K
Sbjct:    8 AQHEHTFDS-VDAGASATYPMQCSALRKGGHVVIKNRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLCPSTHNMDVPNVKRTDYQFSYIDED-FLVLIDSNGEEKRDVKMPEGE-LAKRIEKLEEEGKDFFVGVQTAMGEEAAIDVKEASNK 162          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5AL_HUMAN (Eukaryotic translation initiation factor 5A-1-like OS=Homo sapiens GN=EIF5AL1 PE=1 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 4.248e-40
Identity = 78/142 (54.93%), Postives = 109/142 (76.76%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            DAGAS T+P Q   +RKNG++V+KG PCK+VE+S SKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R D+QLI I +DG++SLL ++G   +DLRLP  + L  +++  +  G+++++TV+S+M EE   A+K
Sbjct:   11 DAGASATFPMQCSALRKNGFVVLKGWPCKIVEMSASKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGI-QDGYLSLLQDSGEVPEDLRLPEGD-LGKEIEQKYDCGEEILITVLSAMTEEAAVAIK 150          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_CHICK (Eukaryotic translation initiation factor 5A-1 OS=Gallus gallus GN=EIF5A1 PE=1 SV=3)

HSP 1 Score: 158.303 bits (399), Expect = 3.045e-38
Identity = 74/126 (58.73%), Postives = 100/126 (79.37%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLV 498
            DAGAS T+P Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF+GKK EDI PS+HN DVP++ R D+QLI I +DGF+SLL ++G  ++DLRLP  E L  +++  +  G++++
Sbjct:   11 DAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRCDFQLIGI-QDGFLSLLQDSGEVREDLRLPEGE-LGREIEQKYDCGEEII 134          
The following BLAST results are available for this feature:
BLAST of CK740330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
IF5A2_HUMAN2.407e-4359.15Eukaryotic translation initiation factor 5A-2 OS=H... [more]
IF5A2_CHICK5.362e-4358.45Eukaryotic translation initiation factor 5A-2 OS=G... [more]
IF5A1_RABIT2.038e-4256.34Eukaryotic translation initiation factor 5A-1 OS=O... [more]
IF5A1_RAT5.928e-4256.34Eukaryotic translation initiation factor 5A-1 OS=R... [more]
IF5A1_MOUSE5.928e-4256.34Eukaryotic translation initiation factor 5A-1 OS=M... [more]
IF5A1_HUMAN5.928e-4256.34Eukaryotic translation initiation factor 5A-1 OS=H... [more]
IF5A1_BOVIN5.928e-4256.34Eukaryotic translation initiation factor 5A-1 OS=B... [more]
IF5A_NEUCR4.248e-4053.16Eukaryotic translation initiation factor 5A OS=Neu... [more]
IF5AL_HUMAN4.248e-4054.93Eukaryotic translation initiation factor 5A-1-like... [more]
IF5A1_CHICK3.045e-3858.73Eukaryotic translation initiation factor 5A-1 OS=G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_6474 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740330 ID=CK740330|Name=CK740330|organism=Citrus sinensis|type=EST|length=637bp
CTCCCTCGCTCGGTCGCCCCCCAGCCTCTCTCAAAATCTCGCTCAGTAAA
TCGGCCGAGTCGGAATCAGTCAGTGCTTAAAACGATGTCGGACGAGGAGC
ATCACTTCGAGTCAAAGGCCGATGCCGGAGCCTCCAAGACTTACCCGCAG
CAAGCTGGTACCATCCGTAAGAATGGCTACATCGTCATCAAAGGCCGTCC
CTGCAAGGTTGTGGAAGTCTCCACCTCCAAGACTGGAAAGCACGGTCATG
CTAAGTGCCACTTTGTTGGAATTGATATCTTCAGTGGAAAGAAGTTGGAA
GATATTGTCCCCTCTTCTCATAACTCTGATGTTCCCCATGTCAACCGTAC
CGACTATCAGTTGATTGATATTTCTGAGGATGGATTTGTGAGTTTGCTGA
CTGAAAATGGGAACACCAAGGATGATCTGAGGCTCCCAACCGATGAGACT
CTGCTGACCCAGCTCAAGGACGGTTTTGCTGAGGGGAAGGACTTGGTTTT
GACTGTCATGTCTTCAATGGGTGAGGAGCAGATCTGTGCCCTCAAGGATA
TTGGCCCAAAGTCGTAGTTGCGCAATATGTGATTATCTGCTATGTCTGGT
TGCATCTGTTTTTTGGAAAATATTTTAATCATCTAGA
back to top