CK740330

Overview
NameCK740330
Unique NameCK740330
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2799 contig Csv1_Contig2799:2..639. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_CAEEL (Eukaryotic translation initiation factor 5A-2 OS=Caenorhabditis elegans GN=iff-2 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.279e-36
Identity = 84/159 (52.83%), Postives = 113/159 (71.07%), Query Frame = 1
Query:   85 MSDEEH---HFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLL-TENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLT-VMSSMGEEQICALK 546
            MSD+ H   HF +  D+GA+ T+P+Q   +RKN +++IKGRPCK+VE+STSKTGKHGHAK H V IDIF+ KKLEDI PS+HN DVP V R +Y L+ I +DG+ SL+  E+   KDDL+LP D  L  Q++D + + +  VL  V+S++GEE I   K
Sbjct:    1 MSDDHHDDEHFHT-GDSGAAATFPKQCSALRKNEHVMIKGRPCKIVEMSTSKTGKHGHAKVHMVAIDIFTSKKLEDICPSTHNMDVPVVKRREYLLMAI-DDGYCSLMDPESCEQKDDLKLP-DTELGQQIRDAYEKDEGSVLVQVVSAIGEEAILGWK 156          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_DICDI (Eukaryotic translation initiation factor 5A OS=Dictyostelium discoideum GN=eif5a PE=1 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 2.850e-36
Identity = 71/145 (48.97%), Postives = 110/145 (75.86%), Query Frame = 1
Query:  112 SKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            ++A +GAS T+P Q   +RKNG++VIKG PCK+V++STSKTGKHGHAK +   IDIF+GKK E+I PS+HN DVP+V+R +Y ++D+ +DG++SLL   G  K+DL LP D+ +  ++     EGK+ +++V+S++G+E + ++K
Sbjct:   13 AQAGSGASLTFPIQCSALRKNGFVVIKGFPCKIVDMSTSKTGKHGHAKVNITAIDIFTGKKYEEICPSTHNIDVPNVSRKEYTVMDV-QDGYLSLLDAGGEVKEDLALPEDD-IGKEITQMLKEGKEPLVSVISALGKEGVVSVK 155          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_CAEEL (Eukaryotic translation initiation factor 5A-1 OS=Caenorhabditis elegans GN=iff-1 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.550e-34
Identity = 78/156 (50.00%), Postives = 109/156 (69.87%), Query Frame = 1
Query:   94 EEHHFESK---ADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLL-TENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLT-VMSSMGEEQICALK 546
            E+HH E +   A++GA+ T+P+Q   +RKN +++I+GRPCK+VE+STSKTGKHGHAK H V IDIF+ KKLEDI PS+HN DVP V R +Y L+ I EDGF SL+  E+   KDDL++P  + L   +++   + +  VL  V+++ GEE I   K
Sbjct:    3 EDHHDEEQFDSAESGAAATFPKQCSALRKNEHVMIRGRPCKIVEMSTSKTGKHGHAKVHMVAIDIFTTKKLEDICPSTHNMDVPVVKRREYILMSI-EDGFCSLMDPESCELKDDLKMPEGD-LGNTIREALEKDEGSVLVQVVAACGEEAILGYK 156          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_THEPD (Translation initiation factor 5A OS=Thermofilum pendens (strain Hrk 5) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.245e-15
Identity = 43/112 (38.39%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  139 TYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDG 474
            T P++AG I+   +IVI G PCKVVEV  SKTGKHG AK   VGI  F G K   +VP+    +VP + +   Q++    D  V L+     +  ++ +P +E + ++L +G
Sbjct:    3 TRPEEAGNIKVGSFIVIDGEPCKVVEVEKSKTGKHGSAKARIVGIGFFDGGKRSIVVPTDARVEVPIIKKFTAQVVAFVGDN-VQLMNLEDYSTFEIPMPQEEEIKSKLSEG 113          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: YE034_YEAST (Putative uncharacterized protein YEL034C-A OS=Saccharomyces cerevisiae GN=YEL034C-A PE=5 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 4.004e-14
Identity = 47/130 (36.15%), Postives = 72/130 (55.38%), Query Frame = -2
Query:  166 ANILEGTDLLLTH*RHDSQNQVLPLSKTVLELGQQSLIGWEPQIILGVPIFSQQTHKSILRNINQLIVGTVDMGNIRVMRRGDNIFQLLSTEDINSNKVALSMTVLSSLGGGDFHNLAGTAFDDDVAILT 555
            ++ LEG     TH   D  +QVL   K+ L+   Q    W   IIL V +   Q  ++++ N+ QL+  ++D  N  V+ R   IFQLL++EDIN N++  S+TVL+SL  G   NL  +  DD+  +L+
Sbjct:   27 SSFLEGDGGFFTHSGDDGNHQVLTFIKSSLQTVTQFTF-WSLDIILSVTVHVHQRQETVI-NVQQLVFVSLDNWNFHVVSRWRQIFQLLTSEDINGNQMDFSVTVLTSLRSGHVDNLTWSTLDDNETVLS 154          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_SCHMA (Eukaryotic translation initiation factor 5A (Fragment) OS=Schistosoma mansoni PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.595e-13
Identity = 33/50 (66.00%), Postives = 40/50 (80.00%), Query Frame = 1
Query:  121 DAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVG 270
            D GASKT P+Q   +RK G++V+K RPCK+VE+STSKTGKHG AK H VG
Sbjct:    3 DFGASKTLPKQCSALRKGGHVVMKDRPCKIVEMSTSKTGKHGSAKVHLVG 52          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_IGNH4 (Translation initiation factor 5A OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.782e-13
Identity = 42/114 (36.84%), Postives = 64/114 (56.14%), Query Frame = 1
Query:  133 SKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDG 474
            SKTY    G ++   +I+I G PCK+VE+S +KTGKHG AK H V I + SG K   + P     +VP + +   Q++ I+ D  V L+        ++ LP +E L ++L+ G
Sbjct:    2 SKTYAT-LGELKPGNFIMIDGEPCKIVEMSKAKTGKHGSAKAHVVAISLISGAKKTFVAPVDTRVEVPIIEKRVGQVLAITGDS-VQLMDMETYDTFEVPLPEEEELKSRLEPG 113          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_SULTO (Translation initiation factor 5A OS=Sulfolobus tokodaii GN=eif5a PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.682e-12
Identity = 37/106 (34.91%), Postives = 60/106 (56.60%), Query Frame = 1
Query:  157 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDG 474
            G ++   Y+VI G PC+VVE+S +KTGKHG AK + V I +F+G+K   + P     +VP + +   Q++    D    +  EN  T  D+  PTD  ++ +++ G
Sbjct:    9 GDLKVGNYVVIDGEPCRVVEISKAKTGKHGSAKANIVAIGLFTGQKRTLMAPVDQQVEVPIIEKHIGQILADKGDTITIMDMENYET-FDIEKPTDADIVDKIRPG 113          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_STAMF (Translation initiation factor 5A OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.682e-12
Identity = 42/114 (36.84%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  133 SKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDG 474
            SKTY    G ++   +I+I G PC++VE+S +KTGKHG AK H V I +F+G K   + P     +VP + +   Q+I    D    +  E   T  ++  P+DE L  +LK G
Sbjct:    2 SKTYAT-LGELKPGNFIIIDGEPCRIVEMSKAKTGKHGSAKAHVVAIGLFTGNKKTLVAPVDQRVEVPVIEKRVGQIIADMGDLLQVMDMETFET-FEVEKPSDEKLREKLKPG 113          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_METS5 (Translation initiation factor 5A OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.748e-12
Identity = 42/130 (32.31%), Postives = 70/130 (53.85%), Query Frame = 1
Query:  157 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            G +++  YIVI G PC+VVEV+ +KTGKHG AK + + + IF+G K   + P     +VP + +   Q+I    D    +  E   T  ++ +PT+E + +++K      KD  +     MG ++I  +K
Sbjct:    9 GEMKEGSYIVIDGEPCRVVEVTKAKTGKHGSAKANIIAVSIFTGAKKTLMAPVDSTVEVPIIEKRMGQVISNVGDKVQIMDLETYET-FEIDMPTEEDVASKIK------KDAEVEYWEVMGRKKIVRVK 131          
The following BLAST results are available for this feature:
BLAST of CK740330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
IF5A2_CAEEL1.279e-3652.83Eukaryotic translation initiation factor 5A-2 OS=C... [more]
IF5A_DICDI2.850e-3648.97Eukaryotic translation initiation factor 5A OS=Dic... [more]
IF5A1_CAEEL4.550e-3450.00Eukaryotic translation initiation factor 5A-1 OS=C... [more]
IF5A_THEPD1.245e-1538.39Translation initiation factor 5A OS=Thermofilum pe... [more]
YE034_YEAST4.004e-1436.15Putative uncharacterized protein YEL034C-A OS=Sacc... [more]
IF5A_SCHMA2.595e-1366.00Eukaryotic translation initiation factor 5A (Fragm... [more]
IF5A_IGNH45.782e-1336.84Translation initiation factor 5A OS=Ignicoccus hos... [more]
IF5A_SULTO1.682e-1234.91Translation initiation factor 5A OS=Sulfolobus tok... [more]
IF5A_STAMF1.682e-1236.84Translation initiation factor 5A OS=Staphylothermu... [more]
IF5A_METS53.748e-1232.31Translation initiation factor 5A OS=Metallosphaera... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_6474 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740330 ID=CK740330|Name=CK740330|organism=Citrus sinensis|type=EST|length=637bp
CTCCCTCGCTCGGTCGCCCCCCAGCCTCTCTCAAAATCTCGCTCAGTAAA
TCGGCCGAGTCGGAATCAGTCAGTGCTTAAAACGATGTCGGACGAGGAGC
ATCACTTCGAGTCAAAGGCCGATGCCGGAGCCTCCAAGACTTACCCGCAG
CAAGCTGGTACCATCCGTAAGAATGGCTACATCGTCATCAAAGGCCGTCC
CTGCAAGGTTGTGGAAGTCTCCACCTCCAAGACTGGAAAGCACGGTCATG
CTAAGTGCCACTTTGTTGGAATTGATATCTTCAGTGGAAAGAAGTTGGAA
GATATTGTCCCCTCTTCTCATAACTCTGATGTTCCCCATGTCAACCGTAC
CGACTATCAGTTGATTGATATTTCTGAGGATGGATTTGTGAGTTTGCTGA
CTGAAAATGGGAACACCAAGGATGATCTGAGGCTCCCAACCGATGAGACT
CTGCTGACCCAGCTCAAGGACGGTTTTGCTGAGGGGAAGGACTTGGTTTT
GACTGTCATGTCTTCAATGGGTGAGGAGCAGATCTGTGCCCTCAAGGATA
TTGGCCCAAAGTCGTAGTTGCGCAATATGTGATTATCTGCTATGTCTGGT
TGCATCTGTTTTTTGGAAAATATTTTAATCATCTAGA
back to top