CK740330

Overview
NameCK740330
Unique NameCK740330
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2799 contig Csv1_Contig2799:2..639. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_CALMQ (Translation initiation factor 5A OS=Caldivirga maquilingensis (strain DSMZ 13496 / IC-167) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.393e-12
Identity = 36/81 (44.44%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  139 TYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISED 381
            T    AG I++  YI+I   PC+VVEV  SKTGKHG AK   VGI +  G K   +VP+    +VP + +   Q+I IS D
Sbjct:    3 TRTASAGDIKEGSYIMIDNMPCRVVEVEKSKTGKHGSAKARIVGIGVIDGVKRTIVVPTDAAVEVPVIEKFTAQVISISGD 83          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_SULAC (Translation initiation factor 5A OS=Sulfolobus acidocaldarius GN=eif5a PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 8.349e-12
Identity = 41/130 (31.54%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  157 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK 546
            G ++   Y++I G PC+VVE++ +KTGKHG AK + V I +F+G+K   + P     +VP + +   Q++    D    +  E+  T  DL  PT+  ++++++ G AE     +   S MG  +I  +K
Sbjct:    9 GDLKVGSYVMIDGEPCRVVEITKAKTGKHGSAKANVVAIGLFTGQKRSLMAPVDQQVEVPIIEKHVGQILADKGDNLTIMDLESYET-FDLEKPTENEIVSKIRPG-AE-----IEYWSVMGRRKIVRVK 131          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_METKA (Translation initiation factor 5A OS=Methanopyrus kandleri GN=eif5a PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.349e-12
Identity = 42/129 (32.56%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  163 IRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKD 549
            ++K  YI+I   PCK+VE +TS  GKHG AK   V + +F GKK     P     DVP + R   Q++    D  V L+        +++ P DE L +QL+ G       ++  M + G+ +I  +K+
Sbjct:   13 LKKGKYIMIDDEPCKIVEYTTSSPGKHGSAKARIVAVGLFDGKKRTLTKPVDAKVDVPVIERKTAQVVSDMGD-TVQLMDMETYETFEVQKPEDEELASQLEPG------TMVEYMEAAGKRKIVGIKE 134          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_HYPBU (Translation initiation factor 5A OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.860e-11
Identity = 38/106 (35.85%), Postives = 58/106 (54.72%), Query Frame = 1
Query:  157 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDG 474
            G ++   YIVI G PC++VE+S +KTGKHG AK H V + +FSG K     P     +VP +++   Q+I    D  V ++        ++  P DE L ++L+ G
Sbjct:    9 GELKVGSYIVIDGEPCRIVEMSKAKTGKHGSAKAHVVAVCLFSGNKKTLTAPVDARVEVPIIDKRIGQVIADMGD-MVQIMDMETYETFEVEKPKDEDLKSKLQPG 113          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_THENV (Translation initiation factor 5A OS=Thermoproteus neutrophilus (strain DSM 2338 / JCM 9278 / V24Sta) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.173e-11
Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 1
Query:  151 QAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISED 381
            +AG +++  Y+VI G PC+VVE+  SKTGKHG AK   V + +F G K    +P     +VP + +   Q++ IS D
Sbjct:    7 EAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTAQVLSISGD 83          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_PYRAE (Translation initiation factor 5A OS=Pyrobaculum aerophilum GN=eif5a PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.173e-11
Identity = 30/77 (38.96%), Postives = 46/77 (59.74%), Query Frame = 1
Query:  151 QAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISED 381
            +AG +++  Y+VI G PC+VVE+  SKTGKHG AK   V + +F G K    +P     +VP + +   Q++ +S D
Sbjct:   13 EAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTAQILSVSGD 89          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_KORCO (Translation initiation factor 5A OS=Korarchaeum cryptofilum (strain OPF8) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.173e-11
Identity = 42/127 (33.07%), Postives = 65/127 (51.18%), Query Frame = 1
Query:  154 AGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQI 534
            AG +RK  Y+++   PC+V+EVS SK GKHG AK       IF G +   I P+    ++P V++   Q+I++     V L+        +L LP D  L ++LK G      + +    SMG+ +I
Sbjct:    8 AGDLRKGSYVILDDEPCEVLEVSKSKPGKHGSAKVRVEARGIFDGARRSKIFPADALVEIPIVDKKTAQVINV-YGNVVQLMDLETYETFELPLPEDPELASRLKSG------IEVEYWESMGKRKI 127          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_SULIL (Translation initiation factor 5A OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.144e-11
Identity = 36/104 (34.62%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  157 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLK 468
            G ++   Y+VI G PC+VVEV+ +KTGKHG AK + V I +FSG K   + P     +VP + +   Q+I   +D    +  E   T  ++  PT++ L ++++
Sbjct:    9 GELKVGSYVVIDGEPCRVVEVTKAKTGKHGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIGQIIADMDDKIQVMDLETYET-FEIEKPTEDELASKIR 111          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_AERPE (Translation initiation factor 5A OS=Aeropyrum pernix GN=eif5a PE=3 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 7.068e-11
Identity = 29/64 (45.31%), Postives = 41/64 (64.06%), Query Frame = 1
Query:  157 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNR 348
            G ++K  YIVI G PC++VE+S +KTGKHG AK H V I +FSG+K   + P      +P + +
Sbjct:    9 GDLKKGSYIVIDGEPCRIVEMSRAKTGKHGSAKAHVVAICVFSGQKKSLVAPVDTRVQIPVIEK 72          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_PYRCJ (Translation initiation factor 5A OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.231e-11
Identity = 30/77 (38.96%), Postives = 45/77 (58.44%), Query Frame = 1
Query:  151 QAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISED 381
            + G +++  Y+VI G PC+VVE+  SKTGKHG AK   V + +F G K    +P     +VP + +   Q++ IS D
Sbjct:    7 EVGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARVVAVGVFDGAKRTLSLPVDAQIEVPIIEKFTAQVLSISGD 83          
The following BLAST results are available for this feature:
BLAST of CK740330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
IF5A_CALMQ6.393e-1244.44Translation initiation factor 5A OS=Caldivirga maq... [more]
IF5A_SULAC8.349e-1231.54Translation initiation factor 5A OS=Sulfolobus aci... [more]
IF5A_METKA8.349e-1232.56Translation initiation factor 5A OS=Methanopyrus k... [more]
IF5A_HYPBU1.860e-1135.85Translation initiation factor 5A OS=Hyperthermus b... [more]
IF5A_THENV3.173e-1140.26Translation initiation factor 5A OS=Thermoproteus ... [more]
IF5A_PYRAE3.173e-1138.96Translation initiation factor 5A OS=Pyrobaculum ae... [more]
IF5A_KORCO3.173e-1133.07Translation initiation factor 5A OS=Korarchaeum cr... [more]
IF5A_SULIL4.144e-1134.62Translation initiation factor 5A OS=Sulfolobus isl... [more]
IF5A_AERPE7.068e-1145.31Translation initiation factor 5A OS=Aeropyrum pern... [more]
IF5A_PYRCJ9.231e-1138.96Translation initiation factor 5A OS=Pyrobaculum ca... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_6474 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740330 ID=CK740330|Name=CK740330|organism=Citrus sinensis|type=EST|length=637bp
CTCCCTCGCTCGGTCGCCCCCCAGCCTCTCTCAAAATCTCGCTCAGTAAA
TCGGCCGAGTCGGAATCAGTCAGTGCTTAAAACGATGTCGGACGAGGAGC
ATCACTTCGAGTCAAAGGCCGATGCCGGAGCCTCCAAGACTTACCCGCAG
CAAGCTGGTACCATCCGTAAGAATGGCTACATCGTCATCAAAGGCCGTCC
CTGCAAGGTTGTGGAAGTCTCCACCTCCAAGACTGGAAAGCACGGTCATG
CTAAGTGCCACTTTGTTGGAATTGATATCTTCAGTGGAAAGAAGTTGGAA
GATATTGTCCCCTCTTCTCATAACTCTGATGTTCCCCATGTCAACCGTAC
CGACTATCAGTTGATTGATATTTCTGAGGATGGATTTGTGAGTTTGCTGA
CTGAAAATGGGAACACCAAGGATGATCTGAGGCTCCCAACCGATGAGACT
CTGCTGACCCAGCTCAAGGACGGTTTTGCTGAGGGGAAGGACTTGGTTTT
GACTGTCATGTCTTCAATGGGTGAGGAGCAGATCTGTGCCCTCAAGGATA
TTGGCCCAAAGTCGTAGTTGCGCAATATGTGATTATCTGCTATGTCTGGT
TGCATCTGTTTTTTGGAAAATATTTTAATCATCTAGA
back to top