CK740331

Overview
NameCK740331
Unique NameCK740331
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length631
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1509 contig Csv1_Contig1509:452..1080. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CYBR1_MOUSE (Cytochrome b reductase 1 OS=Mus musculus GN=Cybrd1 PE=1 SV=2)

HSP 1 Score: 44.2838 bits (103), Expect = 1.612e-11
Identity = 19/44 (43.18%), Postives = 27/44 (61.36%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFLLSW 208
            A F+YHN   + ++YSLHSW+G+  + LY  Q +     FLL W
Sbjct:  103 AVFEYHNVQKVPHMYSLHSWVGLTALILYIQQLVVGFFVFLLPW 146          

HSP 2 Score: 44.2838 bits (103), Expect = 1.612e-11
Identity = 23/82 (28.05%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTF-LENSGLAKYGSEALLVNFTAVITILYGAFVIFSV 425
            GF +F  P     LR+  +P HV  GL ++   +A   +G  EKL F L++     +  E +  N   ++ +++GA + + V
Sbjct:  138 GFFVFLLPWAPPSLRAIVMPIHVYSGLLLFGTVIATVLMGVTEKLFFVLKHPSYHSFPPEGVFTNTLGLLILVFGALIFWIV 219          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CYBR1_PONAB (Cytochrome b reductase 1 OS=Pongo abelii GN=CYBRD1 PE=2 SV=1)

HSP 1 Score: 45.0542 bits (105), Expect = 2.718e-11
Identity = 20/44 (45.45%), Postives = 27/44 (61.36%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFLLSW 208
            A F+ HN + I N+YSLHSW+G+  +  Y +Q L     FLL W
Sbjct:  103 AVFENHNVNNIANMYSLHSWVGLIAVICYLLQLLAGFSVFLLPW 146          

HSP 2 Score: 42.743 bits (99), Expect = 2.718e-11
Identity = 24/83 (28.92%), Postives = 43/83 (51.81%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTF-LENSGLAKYGSEAL-LVNFTAVITILYGAFVIFSV 425
            GF +F  P     LR+  +P HV  G+ ++   +A A +G  EKL F L +   + +  E +  VN   ++ +++GA + + V
Sbjct:  138 GFSVFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGVTEKLIFSLRDPAYSTFPPEGVFFVNTLGLLILVFGALIFWIV 220          
BLAST of CK740331 vs. ExPASy Swiss-Prot
Match: CYAC3_DANRE (Cytochrome b ascorbate-dependent protein 3 OS=Danio rerio GN=cybasc3 PE=2 SV=1)

HSP 1 Score: 47.3654 bits (111), Expect = 7.764e-11
Identity = 20/42 (47.62%), Postives = 26/42 (61.90%), Query Frame = 2
Query:   77 AAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYRVCNFLL 202
            A F +HN     NLYSLHSW+GI   +L+  QW+    +FLL
Sbjct:  101 AVFNFHNVHHTANLYSLHSWVGICTAALFTAQWVMGFTSFLL 142          

HSP 2 Score: 38.891 bits (89), Expect = 7.764e-11
Identity = 28/104 (26.92%), Postives = 47/104 (45.19%), Query Frame = 3
Query:  183 GFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFL---ENSGLAKYGS---EALLVNFTAVITILYGAFVIFSVASQ-----GPAEDDYSY 461
            GF  F  P     +R+   P HV  G  + +L++ +   G  EKL F+     +G   Y +   EA+  N   VI + +G  V+  +++Q      P +D+  Y
Sbjct:  136 GFTSFLLPCTPMAVRAFVKPTHVWMGAMILVLSIVSCISGINEKLFFVLKETTNGTKPYSALPPEAVAANSLGVIIVAFGLVVLKILSNQMWQRPEPGDDEGVY 239          
The following BLAST results are available for this feature:
BLAST of CK740331 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
CYBR1_MOUSE1.612e-1143.18Cytochrome b reductase 1 OS=Mus musculus GN=Cybrd1... [more]
CYBR1_PONAB2.718e-1145.45Cytochrome b reductase 1 OS=Pongo abelii GN=CYBRD1... [more]
CYAC3_DANRE7.764e-1147.62Cytochrome b ascorbate-dependent protein 3 OS=Dani... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_6387 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE62H01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740331 ID=CK740331|Name=CK740331|organism=Citrus sinensis|type=EST|length=631bp
GAGAAAAGAAGTGAAGAAAGTGATACACCTTGTTCTCCATGCTATTGCGC
TTATACTGGGCATTATCGGCATCTATGCTGCTTTCAAATATCATAACGAG
AGCGCCATTGTCAATCTTTATAGCTTGCATTCTTGGCTTGGAATTGCCGT
AATTTCCCTTTATGGCATTCAGTGGTTATACCGGGTTTGTAATTTTCTTC
TATCCTGGAGGATCAACTGGACTAAGAAGTGAATCGCTTCCATGGCACGT
ACTATTCGGGCTGTTTGTGTACATTCTGGCTGTTGCCAATGCAGCCATCG
GGTTCCTGGAGAAGCTCACATTCCTGGAGAATTCAGGCCTTGCTAAATAT
GGCTCTGAGGCTTTGCTTGTCAACTTCACCGCTGTTATCACAATCTTATA
TGGAGCCTTTGTTATATTCTCTGTTGCTTCTCAGGGTCCGGCTGAGGATG
ACTACAGCTATTCAGCTATATAAATATGAGAACTGTGTATTATACACGTT
ATGCTGACTATTAAGTTAGTCATCGGCCTAATTCCTATGCAAAGCTAAAA
TGCGTTGTGTTATTTGTATGTAATTGTAGTCTTTGTTTGTAGACGTTTGA
AACGAGACCATCTTATCAATTACGGTGGGAG
back to top