CK935508

Overview
NameCK935508
Unique NameCK935508
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length718
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1825 contig Csv1_Contig1825:1..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_YEAST (40S ribosomal protein S23 OS=Saccharomyces cerevisiae GN=RPS23A PE=1 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 7.315e-58
Identity = 109/141 (77.30%), Postives = 123/141 (87.23%), Query Frame = 2
Query:  104 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            K RG+ + RKL+ HRR  RWA+ +YKK  LG  +K  PF GSSHAKGIVLEK+GIE+KQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLN+++ENDEVL+AGFGRKG A GDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct:    5 KPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_SACCA (40S ribosomal protein S23 OS=Saccharomyces castellii GN=RPS23A PE=3 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 7.315e-58
Identity = 109/141 (77.30%), Postives = 123/141 (87.23%), Query Frame = 2
Query:  104 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            K RG+ + RKL+ HRR  RWA+ +YKK  LG  +K  PF GSSHAKGIVLEK+GIE+KQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLN+++ENDEVL+AGFGRKG A GDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct:    5 KPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_SACBA (40S ribosomal protein S23 OS=Saccharomyces bayanus GN=RPS23A PE=3 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 7.315e-58
Identity = 109/141 (77.30%), Postives = 123/141 (87.23%), Query Frame = 2
Query:  104 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            K RG+ + RKL+ HRR  RWA+ +YKK  LG  +K  PF GSSHAKGIVLEK+GIE+KQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLN+++ENDEVL+AGFGRKG A GDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct:    5 KPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_CANGA (40S ribosomal protein S23 OS=Candida glabrata GN=RPS23 PE=3 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 7.315e-58
Identity = 109/141 (77.30%), Postives = 123/141 (87.23%), Query Frame = 2
Query:  104 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            K RG+ + RKL+ HRR  RWA+ +YKK  LG  +K  PF GSSHAKGIVLEK+GIE+KQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLN+++ENDEVL+AGFGRKG A GDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct:    5 KPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_GILMI (40S ribosomal protein S23 OS=Gillichthys mirabilis GN=rps23 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.353e-56
Identity = 105/143 (73.43%), Postives = 121/143 (84.62%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M K RG+   RKL++HRR Q+W DK YKK+HLG   K  PF  +SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+ EENDEVL+AGFGRK HAVGDIPGVRFKVV+++ VSLLAL+K  KE+P+S
Sbjct:    1 MGKCRGLRTARKLRNHRREQKWHDKQYKKAHLGTALKANPFGSASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFXEENDEVLVAGFGRKXHAVGDIPGVRFKVVEMANVSLLALYKGXKERPKS 143          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_CIOIN (40S ribosomal protein S23 OS=Ciona intestinalis GN=RPS23 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.353e-56
Identity = 109/143 (76.22%), Postives = 118/143 (82.52%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M K  G+   RKL + RR Q+W D  YKKSHLG   K  PF G+SHAKGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNYIEENDEVL+AGFGR GHAVGDIPGVRFK+VKV+ VSL ALF  KKE+PRS
Sbjct:    1 MGKPSGLRCARKLXNRRRDQKWHDXXYKKSHLGTALKANPFGGASHAKGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLVAGFGRSGHAVGDIPGVRFKIVKVANVSLHALFTGKKERPRS 143          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_SCHPO (40S ribosomal protein S23 OS=Schizosaccharomyces pombe GN=rps23a PE=2 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 6.846e-56
Identity = 105/143 (73.43%), Postives = 121/143 (84.62%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M K  G+ A RKL++HRR +RWAD  YKK  LG  +K  PF GSSHAKGIV+EKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVP+DGCLN+++ENDEVL++GFGRKG A GDIPGVRFKVVKV+GV L ALF EKKEKPR+
Sbjct:    1 MGKPAGLNAARKLRNHRREERWADAHYKKRLLGTAYKSSPFGGSSHAKGIVVEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPHDGCLNFVDENDEVLLSGFGRKGKAKGDIPGVRFKVVKVAGVGLSALFHEKKEKPRA 143          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_TETTH (40S ribosomal protein S12 OS=Tetrahymena thermophila PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 7.085e-53
Identity = 99/137 (72.26%), Postives = 113/137 (82.48%), Query Frame = 2
Query:  104 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            K RG+ AGRKL  HR+ QRWAD  + K  LG+ W+ PF G+SHAKG+V EKIGIE+KQPNSA+RKC RV L KN KKIAAFVP DGCLN++ ENDEVL+AG GR+GHAVGDIPGVRFKVV V G+SLLALFK KKEK
Sbjct:    5 KPRGIRAGRKLARHRKDQRWADNDFNKRLLGSRWRNPFMGASHAKGLVTEKIGIESKQPNSAVRKCVRVLLRKNSKKIAAFVPMDGCLNFLAENDEVLVAGLGRQGHAVGDIPGVRFKVVCVKGISLLALFKGKKEK 141          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_DICDI (40S ribosomal protein S23 OS=Dictyostelium discoideum GN=rps23 PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.998e-52
Identity = 98/141 (69.50%), Postives = 115/141 (81.56%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            M K  G+   RKL++HRR QRW DK YKK+H G   K  PF G+SHA GIV+ ++GIEAKQPNSAIRKC RVQL KNGKKI AFVPNDGCLNYI+END+VL+AG GR GH+VGDIPGVRFKVVKVS VSL+A+++  K+KP
Sbjct:    1 MGKPNGLKTARKLRNHRRVQRWNDKLYKKAHFGTALKANPFGGASHASGIVVSRLGIEAKQPNSAIRKCVRVQLKKNGKKITAFVPNDGCLNYIQENDKVLVAGLGRSGHSVGDIPGVRFKVVKVSSVSLIAIYRGIKDKP 141          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_CENSY (30S ribosomal protein S12P OS=Cenarchaeum symbiosum GN=rps12p PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 4.032e-40
Identity = 84/138 (60.87%), Postives = 104/138 (75.36%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFG-RKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            G+ AGR LK+ ++RQRW+   YK+  LG + K  P  GS  A+GIVLEK+G+EAKQPNSA+RKC RVQLIKNGK I AF+P DG +N+I+E+DEV + G G  +G A+GDIPGVRFKV KV+G SL  L   KKEKPR
Sbjct:    7 GLFAGRVLKAKKKRQRWSISRYKRRELGLDRKANPMGGSPQARGIVLEKVGVEAKQPNSAVRKCVRVQLIKNGKSITAFLPRDGAMNFIDEHDEVHVEGMGATQGGAMGDIPGVRFKVFKVNGTSLHELVIGKKEKPR 144          
The following BLAST results are available for this feature:
BLAST of CK935508 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
RS23_YEAST7.315e-5877.3040S ribosomal protein S23 OS=Saccharomyces cerevis... [more]
RS23_SACCA7.315e-5877.3040S ribosomal protein S23 OS=Saccharomyces castell... [more]
RS23_SACBA7.315e-5877.3040S ribosomal protein S23 OS=Saccharomyces bayanus... [more]
RS23_CANGA7.315e-5877.3040S ribosomal protein S23 OS=Candida glabrata GN=R... [more]
RS23_GILMI2.353e-5673.4340S ribosomal protein S23 OS=Gillichthys mirabilis... [more]
RS23_CIOIN2.353e-5676.2240S ribosomal protein S23 OS=Ciona intestinalis GN... [more]
RS23_SCHPO6.846e-5673.4340S ribosomal protein S23 OS=Schizosaccharomyces p... [more]
RS12_TETTH7.085e-5372.2640S ribosomal protein S12 OS=Tetrahymena thermophi... [more]
RS23_DICDI5.998e-5269.5040S ribosomal protein S23 OS=Dictyostelium discoid... [more]
RS12_CENSY4.032e-4060.8730S ribosomal protein S12P OS=Cenarchaeum symbiosu... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_H02 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_H02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935508 ID=CK935508|Name=CK935508|organism=Citrus sinensis|type=EST|length=718bp
GGAGGAGGGTTTTGGCNNNTTACTCGCGGCGTCCTCTTGCAACTCTCAAG
CTCCAAAGTCGTTCGTTACAGTAAAAAATCCTCTTCGTAACGCCAACATG
AGGAAGACACGTGGAATGGGAGCTGGTCGCAAGCTGAAGAGCCACCGCAG
AAGACAAAGGTGGGCTGATAAGTCATACAAGAAATCCCACCTTGGCAATG
AATGGAAGAAGCCATTTGCTGGCTCTTCCCATGCAAAAGGCATTGTTCTT
GAGAAAATCGGTATCGAGGCAAAGCAGCCCAACTCTGCTATCAGAAAATG
CGCTCGAGTTCAGCTGATCAAGAATGGAAAGAAGATTGCAGCTTTCGTAC
CAAACGATGGTTGTTTGAACTACATTGAAGAAAATGACGAGGTACTTATT
GCAGGATTTGGTCGAAAGGGGCATGCTGTGGGAGATATTCCTGGTGTTAG
ATTTAAGGTTGTCAAGGTTTCAGGCGTGTCTCTTCTGGCCCTCTTCAAGG
AGAAGAAGGAGAAACCAAGATCCTAAACTCCTGATTCAAGATACTTCACC
ATGTTTTCTTTTTTTAGCACTTTATTTTCATTAGTCCCTGTTGATTACTT
TTTTCCTTTATCATGTATTGCTGTTGTGAGAACTTTTTGGTTTTTTTCCC
TCTGTTGAGACTGTTAGTAAATTAGTATCTGTCTCTTTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA
back to top