CK935508

Overview
NameCK935508
Unique NameCK935508
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length718
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1825 contig Csv1_Contig1825:1..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_STAMF (30S ribosomal protein S12P OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=rps12p PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 7.118e-37
Identity = 78/144 (54.17%), Postives = 105/144 (72.92%), Query Frame = 2
Query:   92 ANMRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            A  +   G+ A RKL+  R + RW+ + +K   LG + K  P  G+  A+GIVLEK+G+EA+QPNSA+RKC RVQL KNGK + AFVP DG +NYI+E+DEV+I G  G +G ++GDIPGVR+KV+ V+GVSL AL+  KK+KP
Sbjct:    2 AGKKAPNGLFAARKLRRKRLKFRWSQREFKIKMLGLKKKHDPLEGAPMARGIVLEKVGVEARQPNSAVRKCVRVQLAKNGKVVTAFVPFDGGINYIDEHDEVIIEGIGGPRGRSMGDIPGVRYKVIMVNGVSLKALYLGKKQKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_PYRKO (30S ribosomal protein S12P OS=Pyrococcus kodakaraensis GN=rps12p PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 7.118e-37
Identity = 82/145 (56.55%), Postives = 103/145 (71.03%), Query Frame = 2
Query:   92 ANMRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            A  +   G  AGRKLK  R++ RW+D  YK+  L   E   P  G+  A+GIVLEKI +EAKQPNSA+RK  RVQLIKNGK + AF P DG +N+I+E+DEV+I G  G KG ++GDIPG+R+KVVKV+ VSL  L K +KEKPR
Sbjct:    2 AGKKAPYGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSAMRKAVRVQLIKNGKVVTAFTPGDGAINHIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPR 146          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_HALSA (30S ribosomal protein S12P OS=Halobacterium salinarium GN=rps12p PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.214e-36
Identity = 78/139 (56.12%), Postives = 99/139 (71.22%), Query Frame = 2
Query:  107 TRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            T G  A RKLK  R+++RW+D  Y +   G   K  P  G+   +GIVLEK+GIEAKQPNSAIRKC RVQLIKNGK++ AF P DG +++I+E+DEV IAG  G KG A+GD+ GV +KV KV+GVSL+ L +   EKP
Sbjct:    2 TNGKYAARKLKKDRQQRRWSDSEYARRERGLGKKSDPLEGAPQGRGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYKVEKVNGVSLIELVRGNAEKP 140          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_PYRHO (30S ribosomal protein S12P OS=Pyrococcus horikoshii GN=rps12p PE=3 SV=2)

HSP 1 Score: 152.14 bits (383), Expect = 2.705e-36
Identity = 80/138 (57.97%), Postives = 100/138 (72.46%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            G  AGRKLK  R++ RW+D  YK+  L   E   P  G+  A+GIVLEKI +EAKQPNS +RK  RVQLIKNGK + AF P DG +N+I+E+DEV+I G  G KG ++GDIPG+R+KVVKV+ VSL  L K +KEKPR
Sbjct:    9 GEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAINFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPR 146          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METST (30S ribosomal protein S12P OS=Methanosphaera stadtmanae (strain DSM 3091) GN=rps12p PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.705e-36
Identity = 78/137 (56.93%), Postives = 98/137 (71.53%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ A +KLK +R+  RW D  YK+  LG   K  P  GS  A+GIV+EK+GIEAKQPNSAIRKC RVQLIKNGK+I AF P DG + +I+E+DEV+I G  G  G ++GDIPGVR+KV KV+ V+L  +   K EKP
Sbjct:    3 GLFAAKKLKDNRQNFRWKDTQYKRKTLGLNIKADPLEGSPQARGIVIEKVGIEAKQPNSAIRKCVRVQLIKNGKQITAFAPGDGAIGFIDEHDEVMIEGIGGPSGRSMGDIPGVRWKVTKVNNVALSEMVSGKIEKP 139          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_HALWD (30S ribosomal protein S12P OS=Haloquadratum walsbyi (strain DSM 16790) GN=rps12p PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.614e-36
Identity = 77/137 (56.20%), Postives = 98/137 (71.53%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G  A RKLK  R+++RW+D  Y +   G   K  P  G+   +GIVLEK+GIEAKQPNSAIRKC RVQLIKNGK++ AF P DG +++I+E+DEV IAG  G KG A+GD+ GV +KV KV+GVSL+ L +   EKP
Sbjct:    4 GKYAARKLKQDRQQRRWSDSEYARRERGLGAKSDPLEGAPQGRGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYKVEKVNGVSLIELVRGNAEKP 140          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METTH (30S ribosomal protein S12P OS=Methanobacterium thermoautotrophicum GN=rps12p PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 6.025e-36
Identity = 77/137 (56.20%), Postives = 100/137 (72.99%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ A +KLKS R++ +W D  YK+  L  + K  P  G+  A+GIV+EK+GIEAKQPNSAIRKC RVQLIKNGK+I AF P DG + +I+E+DEV++ G  G  G ++GDIPGVR+KV KV+ VSL  + K K EKP
Sbjct:    3 GLFAAKKLKSKRQKFKWKDTHYKRRSLRLDVKADPLEGAPQARGIVIEKVGIEAKQPNSAIRKCVRVQLIKNGKQITAFAPGDGAIGFIDEHDEVVVEGIGGPSGRSMGDIPGVRWKVTKVNNVSLQEMVKGKIEKP 139          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_HALMA (30S ribosomal protein S12P OS=Haloarcula marismortui GN=rps12p PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 6.025e-36
Identity = 77/137 (56.20%), Postives = 97/137 (70.80%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G  A RKLK  R++ RW+D  Y +   G   K  P  G+   +GIVLEK+GIEAKQPNSAIRKC RVQLIKNGK++ AF P DG +++I+E+DEV IAG  G KG A+GD+ GV +KV KV+GVSL+ L +   EKP
Sbjct:    4 GKYAARKLKKDRQKHRWSDTDYARRERGLGKKSDPLEGAPQGRGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYKVEKVNGVSLIELVRGNAEKP 140          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_NATPD (30S ribosomal protein S12P OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=rps12p PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 7.870e-36
Identity = 77/137 (56.20%), Postives = 97/137 (70.80%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G  A RKLK  R++ RW+D  Y +   G   K  P  G+   +GIVLEK+GIEAKQPNSAIRKC RVQLIKNGK++ AF P DG +++I+E+DEV IAG  G KG A+GD+ GV +KV KV+GVSL+ L +   EKP
Sbjct:    4 GKYAARKLKQDRQKHRWSDSDYARRARGLGKKSDPLEGAPQGRGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYKVEKVNGVSLIELVRGNAEKP 140          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_THEPD (30S ribosomal protein S12P OS=Thermofilum pendens (strain Hrk 5) GN=rps12p PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.028e-35
Identity = 74/141 (52.48%), Postives = 104/141 (73.76%), Query Frame = 2
Query:  101 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            +  RGM A RKL+  R++ RW+D  YK+  L  + K  P  G+  A+GIV+EK+GIE++QPNSA+RKC RVQL+KNGK + AF+P DG L ++ E+DEV+I G  G +G A GD+PGVR+KV+KV+GVSL  + + +K+KP
Sbjct:    5 KSPRGMFAARKLELKRKKFRWSDLEYKRRILQLKKKVDPLEGAPQARGIVVEKVGIESRQPNSAVRKCVRVQLLKNGKVVTAFLPGDGALLFVNEHDEVVIEGIGGPEGRAYGDLPGVRWKVIKVNGVSLKEILRGRKQKP 145          
The following BLAST results are available for this feature:
BLAST of CK935508 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
RS12_STAMF7.118e-3754.1730S ribosomal protein S12P OS=Staphylothermus mari... [more]
RS12_PYRKO7.118e-3756.5530S ribosomal protein S12P OS=Pyrococcus kodakarae... [more]
RS12_HALSA1.214e-3656.1230S ribosomal protein S12P OS=Halobacterium salina... [more]
RS12_PYRHO2.705e-3657.9730S ribosomal protein S12P OS=Pyrococcus horikoshi... [more]
RS12_METST2.705e-3656.9330S ribosomal protein S12P OS=Methanosphaera stadt... [more]
RS12_HALWD4.614e-3656.2030S ribosomal protein S12P OS=Haloquadratum walsby... [more]
RS12_METTH6.025e-3656.2030S ribosomal protein S12P OS=Methanobacterium the... [more]
RS12_HALMA6.025e-3656.2030S ribosomal protein S12P OS=Haloarcula marismort... [more]
RS12_NATPD7.870e-3656.2030S ribosomal protein S12P OS=Natronomonas pharaon... [more]
RS12_THEPD1.028e-3552.4830S ribosomal protein S12P OS=Thermofilum pendens ... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_H02 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_H02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935508 ID=CK935508|Name=CK935508|organism=Citrus sinensis|type=EST|length=718bp
GGAGGAGGGTTTTGGCNNNTTACTCGCGGCGTCCTCTTGCAACTCTCAAG
CTCCAAAGTCGTTCGTTACAGTAAAAAATCCTCTTCGTAACGCCAACATG
AGGAAGACACGTGGAATGGGAGCTGGTCGCAAGCTGAAGAGCCACCGCAG
AAGACAAAGGTGGGCTGATAAGTCATACAAGAAATCCCACCTTGGCAATG
AATGGAAGAAGCCATTTGCTGGCTCTTCCCATGCAAAAGGCATTGTTCTT
GAGAAAATCGGTATCGAGGCAAAGCAGCCCAACTCTGCTATCAGAAAATG
CGCTCGAGTTCAGCTGATCAAGAATGGAAAGAAGATTGCAGCTTTCGTAC
CAAACGATGGTTGTTTGAACTACATTGAAGAAAATGACGAGGTACTTATT
GCAGGATTTGGTCGAAAGGGGCATGCTGTGGGAGATATTCCTGGTGTTAG
ATTTAAGGTTGTCAAGGTTTCAGGCGTGTCTCTTCTGGCCCTCTTCAAGG
AGAAGAAGGAGAAACCAAGATCCTAAACTCCTGATTCAAGATACTTCACC
ATGTTTTCTTTTTTTAGCACTTTATTTTCATTAGTCCCTGTTGATTACTT
TTTTCCTTTATCATGTATTGCTGTTGTGAGAACTTTTTGGTTTTTTTCCC
TCTGTTGAGACTGTTAGTAAATTAGTATCTGTCTCTTTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA
back to top