CK935508

Overview
NameCK935508
Unique NameCK935508
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length718
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1825 contig Csv1_Contig1825:1..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_SULAC (30S ribosomal protein S12P OS=Sulfolobus acidocaldarius GN=rps12p PE=3 SV=3)

HSP 1 Score: 150.214 bits (378), Expect = 1.028e-35
Identity = 76/144 (52.78%), Postives = 107/144 (74.31%), Query Frame = 2
Query:   92 ANMRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            A  +  +G+ A RKL+  R +  W+ +S+K+  L  + K  P  G+  A+GIVLEK+GIE++QPNSA+RK  RVQL+KNG+ + AFVP DG +N+I+E+DEV+IAG  G  G ++GD+PGVR+KVV V+GVSL AL+K KK+KP
Sbjct:    2 AGSKSPKGLFAARKLRLKRLKFSWSQRSFKRRMLALKEKFDPLEGAPMARGIVLEKVGIESRQPNSAVRKAVRVQLVKNGRIVTAFVPGDGGVNFIDEHDEVVIAGIGGTLGRSMGDLPGVRYKVVMVNGVSLDALYKGKKQKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_PYRFU (30S ribosomal protein S12P OS=Pyrococcus furiosus GN=rps12p PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.342e-35
Identity = 79/138 (57.25%), Postives = 99/138 (71.74%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            G  AGRKLK  R++ RW+D  YK+  L   E   P  G+  A+GIVLEKI +EAKQPNS +RK  RVQLIKNGK + AF P DG + +I+E+DEV+I G  G KG ++GDIPG+R+KVVKV+ VSL  L K +KEKPR
Sbjct:    9 GEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAIKFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPR 146          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_PYRAB (30S ribosomal protein S12P OS=Pyrococcus abyssi GN=rps12p PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.342e-35
Identity = 79/138 (57.25%), Postives = 99/138 (71.74%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            G  AGRKLK  R++ RW+D  YK+  L   E   P  G+  A+GIVLEKI +EAKQPNS +RK  RVQLIKNGK + AF P DG + +I+E+DEV+I G  G KG ++GDIPG+R+KVVKV+ VSL  L K +KEKPR
Sbjct:    9 GEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAIKFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPR 146          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_IGNH4 (30S ribosomal protein S12P OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps12p PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.290e-35
Identity = 76/137 (55.47%), Postives = 102/137 (74.45%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ A RKL+  R + RW+ + +K+  L  + K  P  G+  A+GIVLEK+G+EA++PNSA+RKC RVQL+KNGK + AFVP DG LN I E+DEV+I G  G +G ++GDIPGVR+KVV V+GVSL A+ K KK+KP
Sbjct:    9 GLFAARKLERKRLKFRWSQREFKRRMLKLKEKYDPLEGAPMARGIVLEKVGVEARKPNSAVRKCVRVQLVKNGKVVTAFVPGDGGLNVISEHDEVVIVGIGGPRGRSMGDIPGVRYKVVLVNGVSLDAILKGKKQKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_SULTO (30S ribosomal protein S12P OS=Sulfolobus tokodaii GN=rps12p PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.990e-35
Identity = 75/144 (52.08%), Postives = 106/144 (73.61%), Query Frame = 2
Query:   92 ANMRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            A  +  +GM A RKL+  R + RW  + +K+  L  + K  P  G+  A+G+VLEK+GIE++QPNSA+RK  RVQL+KNG+ + AFVP DG +N+I+E+DEV+IAG  G  G ++GD+PGVR+KV+ V+GVSL AL+K KK+KP
Sbjct:    2 AGGKSPKGMFAARKLRLKRLKFRWHQRKFKRRMLKLKEKFDPLEGAPMARGVVLEKVGIESRQPNSAVRKAVRVQLVKNGRIVTAFVPGDGGVNFIDEHDEVVIAGIGGTLGRSMGDLPGVRYKVIMVNGVSLDALYKGKKQKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_HYPBU (30S ribosomal protein S12P OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=rps12p PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 6.662e-35
Identity = 74/142 (52.11%), Postives = 105/142 (73.94%), Query Frame = 2
Query:  101 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            +   G+ A RKL+  R + RW+++ +K   LG + K  P  G+  A+GIVLEK+G+EA+QPNSA+RKC RVQLIKNG+ + AFVP DG L  ++E+DEVLI G  G +G ++GDIPGVR++VV V+GVSL A+ + +K+KP+
Sbjct:    5 KSPNGLFAARKLRRKRLKFRWSEREFKIRMLGLKKKYDPLEGAPMARGIVLEKVGVEARQPNSAVRKCVRVQLIKNGRIVTAFVPGDGGLLVVDEHDEVLIEGIGGPRGRSMGDIPGVRYRVVTVNGVSLRAILEGRKQKPQ 146          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_ARCFU (30S ribosomal protein S12P OS=Archaeoglobus fulgidus GN=rps12p PE=3 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 6.662e-35
Identity = 76/137 (55.47%), Postives = 101/137 (73.72%), Query Frame = 2
Query:  110 RGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEK 514
            RG+ A RKL  +R++ RW+D+ + +  LG   K  P  G+  A+GIVLEKIGIEA+QPNSAIRK  RVQLIKNG++I AF P DG +N+I+E+DEV++    GR G ++GDIPGVR+KVVKV+  SL  L + +KEK
Sbjct:    3 RGLFAARKLMENRKKFRWSDRRFVRRTLGLAAKADPLEGAPMARGIVLEKIGIEARQPNSAIRKAVRVQLIKNGRQITAFCPGDGAINFIDEHDEVIVEKIGGRMGRSMGDIPGVRYKVVKVNNTSLRELVRGRKEK 139          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METTP (30S ribosomal protein S12P OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=rps12p PE=3 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 1.484e-34
Identity = 72/137 (52.55%), Postives = 99/137 (72.26%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ A RK++   ++ RW+D  Y +  LG + K  P  G+  A+GIVLEK+G+EAKQPNSAIRKC R+QLIKNG+++ AF P DG + +I+E+DEV++    GR G ++GDIPGVRFKVV V+ VSL  +   +KEKP
Sbjct:    4 GINAARKMEDDWKKLRWSDPHYCRRALGLKVKADPLGGAPRARGIVLEKVGVEAKQPNSAIRKCVRIQLIKNGRQVTAFCPGDGAIGFIDEHDEVVVERIGGRMGRSMGDIPGVRFKVVAVNNVSLEEMVSGRKEKP 140          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_UNCMA (30S ribosomal protein S12P OS=Uncultured methanogenic archaeon RC-I GN=rps12p PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.532e-34
Identity = 76/137 (55.47%), Postives = 97/137 (70.80%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G  A RKL   R+  RW+D+ Y +  L  +E   P  G+  AKGIVLEK+G+EAKQPNSAIRKC R+QLIKNG++I AF P DG +N+I+E+DEV I G  GR G + GDIPGVRF+V KV+ VSL  +   K++KP
Sbjct:    4 GKFACRKLVHDRKLYRWSDRDYARRVLRLDEKADPLEGAPQAKGIVLEKVGVEAKQPNSAIRKCIRIQLIKNGRQITAFCPGDGAINFIDEHDEVTIEGIGGRMGGSYGDIPGVRFRVFKVNDVSLEEMVAGKRDKP 140          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METS3 (30S ribosomal protein S12P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps12p PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.532e-34
Identity = 74/137 (54.01%), Postives = 98/137 (71.53%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G+ A +KLK +R+  +W D  YK+  L  + K  P  G+  A+GIV+EK+GIEAKQPNSAIRKC RVQLIKNGK++ AF P DG + +I+E+DEV+I G  G  G ++GDIPGVR+KV KV+ V+L  +   K EKP
Sbjct:    3 GLFAAKKLKKNRQNFKWKDVDYKRKALRLDVKADPLEGAPQARGIVIEKVGIEAKQPNSAIRKCVRVQLIKNGKQLTAFAPGDGAIGFIDEHDEVMIEGIGGPSGRSMGDIPGVRWKVSKVNNVALSEMVSGKIEKP 139          
The following BLAST results are available for this feature:
BLAST of CK935508 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
RS12_SULAC1.028e-3552.7830S ribosomal protein S12P OS=Sulfolobus acidocald... [more]
RS12_PYRFU1.342e-3557.2530S ribosomal protein S12P OS=Pyrococcus furiosus ... [more]
RS12_PYRAB1.342e-3557.2530S ribosomal protein S12P OS=Pyrococcus abyssi GN... [more]
RS12_IGNH42.290e-3555.4730S ribosomal protein S12P OS=Ignicoccus hospitali... [more]
RS12_SULTO2.990e-3552.0830S ribosomal protein S12P OS=Sulfolobus tokodaii ... [more]
RS12_HYPBU6.662e-3552.1130S ribosomal protein S12P OS=Hyperthermus butylic... [more]
RS12_ARCFU6.662e-3555.4730S ribosomal protein S12P OS=Archaeoglobus fulgid... [more]
RS12_METTP1.484e-3452.5530S ribosomal protein S12P OS=Methanosaeta thermop... [more]
RS12_UNCMA2.532e-3455.4730S ribosomal protein S12P OS=Uncultured methanoge... [more]
RS12_METS32.532e-3454.0130S ribosomal protein S12P OS=Methanobrevibacter s... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_H02 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_H02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935508 ID=CK935508|Name=CK935508|organism=Citrus sinensis|type=EST|length=718bp
GGAGGAGGGTTTTGGCNNNTTACTCGCGGCGTCCTCTTGCAACTCTCAAG
CTCCAAAGTCGTTCGTTACAGTAAAAAATCCTCTTCGTAACGCCAACATG
AGGAAGACACGTGGAATGGGAGCTGGTCGCAAGCTGAAGAGCCACCGCAG
AAGACAAAGGTGGGCTGATAAGTCATACAAGAAATCCCACCTTGGCAATG
AATGGAAGAAGCCATTTGCTGGCTCTTCCCATGCAAAAGGCATTGTTCTT
GAGAAAATCGGTATCGAGGCAAAGCAGCCCAACTCTGCTATCAGAAAATG
CGCTCGAGTTCAGCTGATCAAGAATGGAAAGAAGATTGCAGCTTTCGTAC
CAAACGATGGTTGTTTGAACTACATTGAAGAAAATGACGAGGTACTTATT
GCAGGATTTGGTCGAAAGGGGCATGCTGTGGGAGATATTCCTGGTGTTAG
ATTTAAGGTTGTCAAGGTTTCAGGCGTGTCTCTTCTGGCCCTCTTCAAGG
AGAAGAAGGAGAAACCAAGATCCTAAACTCCTGATTCAAGATACTTCACC
ATGTTTTCTTTTTTTAGCACTTTATTTTCATTAGTCCCTGTTGATTACTT
TTTTCCTTTATCATGTATTGCTGTTGTGAGAACTTTTTGGTTTTTTTCCC
TCTGTTGAGACTGTTAGTAAATTAGTATCTGTCTCTTTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA
back to top