CK935508

Overview
NameCK935508
Unique NameCK935508
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length718
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1825 contig Csv1_Contig1825:1..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METMJ (30S ribosomal protein S12P OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps12p PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.532e-34
Identity = 76/138 (55.07%), Postives = 93/138 (67.39%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            G  A RKLK      RW D  Y +  LG + K  P  G+   +GIVLEK+G+EAKQPNSAIRKC RVQLIKNG+++ AF   DG +N+I+E+DEV I G  GR G + GDIPGVRF V KV+ VSL  +   +KEKPR
Sbjct:    4 GKFAARKLKRDANNNRWHDTGYARRQLGLDVKADPLEGAPQGRGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGRQVTAFAVGDGAINFIDEHDEVEIEGIGGRLGRSKGDIPGVRFVVTKVNNVSLREMVTGRKEKPR 141          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_AERPE (30S ribosomal protein S12P OS=Aeropyrum pernix GN=rps12p PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.532e-34
Identity = 73/138 (52.90%), Postives = 103/138 (74.64%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            G+ A RKL+  R + RW+ + ++   L  + K  P  G+  A+GIVLEK+G+EA+QPNSA+RKC RVQL+KN K + AFVP DG + Y++E+DEV+I G  G +G ++GDIPGVR++VV V+GVSL AL++ KK+KPR
Sbjct:    9 GLFAARKLRRKRLKFRWSQREFRIRMLDLKRKYDPLEGAPMARGIVLEKVGVEARQPNSALRKCVRVQLVKNKKVVTAFVPRDGGILYVDEHDEVIIEGIGGPRGRSMGDIPGVRYRVVMVNGVSLKALWEGKKQKPR 146          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_SULSO (30S ribosomal protein S12P OS=Sulfolobus solfataricus GN=rps12p PE=3 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 3.306e-34
Identity = 73/141 (51.77%), Postives = 104/141 (73.76%), Query Frame = 2
Query:  101 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            +  +G+ A RKL+  R + R + + YK   L  + K  P  G+  A+GIVLEK+GIE++QPNSA+RKC RVQL++NG+ + AFVP DG +N+I+E+DEV+I G  G  G ++GD+PGVR+KV+ V+GVSL AL+K KK+KP
Sbjct:    5 KSPKGIYAARKLRLKRLKFRRSQRKYKTKILKLKEKYDPLGGAPMARGIVLEKVGIESRQPNSAVRKCVRVQLVRNGRVVTAFVPGDGGVNFIDEHDEVIITGIGGTLGRSMGDLPGVRYKVIMVNGVSLDALYKGKKQKP 145          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METBU (30S ribosomal protein S12P OS=Methanococcoides burtonii (strain DSM 6242) GN=rps12p PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.318e-34
Identity = 73/138 (52.90%), Postives = 96/138 (69.57%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            G  A  +L+  R+  RW D  Y +  LG + K  P +G+   +GIVLEK+G+EAKQPNSAIRKC R+QLIKNG++  AF P DG +N+I+E+DEV +    GR G A+GDIPGVRFKV+ V+ VSL  +   +KEKPR
Sbjct:    4 GKYAAHRLQQVRKDARWKDTGYSRRTLGLDIKSDPLSGAPQGRGIVLEKVGVEAKQPNSAIRKCVRIQLIKNGRQATAFCPGDGAINFIDEHDEVTVERIGGRMGGAMGDIPGVRFKVIAVNNVSLREMVIGRKEKPR 141          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_HALMO (30S ribosomal protein S12P OS=Halococcus morrhuae GN=rps12p PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.366e-34
Identity = 74/137 (54.01%), Postives = 94/137 (68.61%), Query Frame = 2
Query:  113 GMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 517
            G  A RKLK  R+  RW+D  Y +   G  E      G+   +GIVLEK+GIEAKQPNSAIRKC RVQLIKNG+++ AF P DG +++I+E+DEV IAG  G KG A+GD+  V +KV KV+GVSL+ L +   EKP
Sbjct:    4 GKYAARKLKKDRQNHRWSDSKYARRARGLKEKTDALEGAPQGRGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGQQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSAVNYKVEKVNGVSLIELVRGNAEKP 140          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METHJ (30S ribosomal protein S12P OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=rps12p PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.143e-33
Identity = 76/139 (54.68%), Postives = 97/139 (69.78%), Query Frame = 2
Query:  110 RGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            +G  A RKLK    R RW+D  + ++  G + K  P  G+   +GIVLEKIG+EAKQPNSAIRKC RVQLIKNG++++AF   DG +N+I+E+DEV I G  GR G ++GDIPGVRF V KV+ V L  L   +KEKPR
Sbjct:    3 QGKFAARKLKRDSARFRWSDPHFARTAGGLKLKSDPLEGAPQGRGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGRQVSAFAVGDGAINFIDEHDEVEIEGIGGRLGRSMGDIPGVRFVVTKVNNVCLHELVIGRKEKPR 141          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METB6 (30S ribosomal protein S12P OS=Methanoregula boonei (strain 6A8) GN=rps12p PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.799e-33
Identity = 73/139 (52.52%), Postives = 97/139 (69.78%), Query Frame = 2
Query:  110 RGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            +G  A RKL    ++ RW+DK+Y +  L  + K  P  G+  A+GIVLEK+G+EAKQPNSAIRKC RVQLIKNG+++ AF   DG +N+I+E+DEV I G  GR G ++GDIPGVR+ V  V+ V L  +   +KEKPR
Sbjct:    3 QGKFAARKLVRDSKKFRWSDKNYARRELNLDVKSDPLEGAPQARGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGRQVTAFAVGDGAINFIDEHDEVEIEGIGGRLGRSMGDIPGVRYVVTSVNNVCLHEMVIGRKEKPR 141          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METAC (30S ribosomal protein S12P OS=Methanosarcina acetivorans GN=rps12p PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.799e-33
Identity = 75/139 (53.96%), Postives = 94/139 (67.63%), Query Frame = 2
Query:  110 RGMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            +G  A   LK  R+  RW D  Y +  LG N    P  G+   +GIVLEK+G+EAKQPNSAIRKC RVQLIKNG+++ AF P DG +N+I+E+DEV +    GR G A+GDIPGVRFKV+ V+ VSL  L   + EKPR
Sbjct:    3 KGKYAANILKQTRKDARWKDTYYGRRVLGLNVKADPLGGAPQGRGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGRQVTAFCPGDGAVNFIDEHDEVTVEKIGGRMGGAMGDIPGVRFKVIAVNNVSLNQLVIGRMEKPR 141          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METMA (30S ribosomal protein S12P OS=Methanosarcina mazei GN=rps12p PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.774e-33
Identity = 74/139 (53.24%), Postives = 94/139 (67.63%), Query Frame = 2
Query:  110 RGMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            +G  A   LK  R+  RW D  Y +  LG N    P  G+   +GIVLEK+G+EAKQPNSAIRKC R+QLIKNG+++ AF P DG +N+I+E+DEV +    GR G A+GDIPGVRFKV+ V+ VSL  L   + EKPR
Sbjct:    3 KGKYAANILKQTRKDARWKDTYYGRRVLGLNVKADPLGGAPQGRGIVLEKVGVEAKQPNSAIRKCVRIQLIKNGRQVTAFCPGDGAVNFIDEHDEVTVERIGGRMGGAMGDIPGVRFKVIAVNNVSLNQLVIGRLEKPR 141          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS12_METBF (30S ribosomal protein S12P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps12p PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.774e-33
Identity = 73/139 (52.52%), Postives = 94/139 (67.63%), Query Frame = 2
Query:  110 RGMGAGRKLKSHRRRQRWADKSYKKSHLG-NEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGF-GRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR 520
            +G  A   LK  R+  RW D SY +  LG N    P  G+   +GIVLEK+G+EAKQPNSAIRKC R+QLIKNG+++ AF P DG +N+I+E+DEV +    GR G A+GDIPGVRF+V  V+ VSL  +   + EKPR
Sbjct:    3 KGKYAANILKQTRKNARWKDTSYGRRVLGLNVKADPLGGAPQGRGIVLEKVGVEAKQPNSAIRKCVRIQLIKNGRQVTAFCPGDGAVNFIDEHDEVTVERIGGRMGGAMGDIPGVRFRVTAVNNVSLNQMVIGRLEKPR 141          
The following BLAST results are available for this feature:
BLAST of CK935508 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
RS12_METMJ2.532e-3455.0730S ribosomal protein S12P OS=Methanoculleus maris... [more]
RS12_AERPE2.532e-3452.9030S ribosomal protein S12P OS=Aeropyrum pernix GN=... [more]
RS12_SULSO3.306e-3451.7730S ribosomal protein S12P OS=Sulfolobus solfatari... [more]
RS12_METBU4.318e-3452.9030S ribosomal protein S12P OS=Methanococcoides bur... [more]
RS12_HALMO7.366e-3454.0130S ribosomal protein S12P OS=Halococcus morrhuae ... [more]
RS12_METHJ2.143e-3354.6830S ribosomal protein S12P OS=Methanospirillum hun... [more]
RS12_METB62.799e-3352.5230S ribosomal protein S12P OS=Methanoregula boonei... [more]
RS12_METAC2.799e-3353.9630S ribosomal protein S12P OS=Methanosarcina aceti... [more]
RS12_METMA4.774e-3353.2430S ribosomal protein S12P OS=Methanosarcina mazei... [more]
RS12_METBF4.774e-3352.5230S ribosomal protein S12P OS=Methanosarcina barke... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_H02 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_H02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935508 ID=CK935508|Name=CK935508|organism=Citrus sinensis|type=EST|length=718bp
GGAGGAGGGTTTTGGCNNNTTACTCGCGGCGTCCTCTTGCAACTCTCAAG
CTCCAAAGTCGTTCGTTACAGTAAAAAATCCTCTTCGTAACGCCAACATG
AGGAAGACACGTGGAATGGGAGCTGGTCGCAAGCTGAAGAGCCACCGCAG
AAGACAAAGGTGGGCTGATAAGTCATACAAGAAATCCCACCTTGGCAATG
AATGGAAGAAGCCATTTGCTGGCTCTTCCCATGCAAAAGGCATTGTTCTT
GAGAAAATCGGTATCGAGGCAAAGCAGCCCAACTCTGCTATCAGAAAATG
CGCTCGAGTTCAGCTGATCAAGAATGGAAAGAAGATTGCAGCTTTCGTAC
CAAACGATGGTTGTTTGAACTACATTGAAGAAAATGACGAGGTACTTATT
GCAGGATTTGGTCGAAAGGGGCATGCTGTGGGAGATATTCCTGGTGTTAG
ATTTAAGGTTGTCAAGGTTTCAGGCGTGTCTCTTCTGGCCCTCTTCAAGG
AGAAGAAGGAGAAACCAAGATCCTAAACTCCTGATTCAAGATACTTCACC
ATGTTTTCTTTTTTTAGCACTTTATTTTCATTAGTCCCTGTTGATTACTT
TTTTCCTTTATCATGTATTGCTGTTGTGAGAACTTTTTGGTTTTTTTCCC
TCTGTTGAGACTGTTAGTAAATTAGTATCTGTCTCTTTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA
back to top