EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_SECCE (Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.578e-47
Identity = 81/120 (67.50%), Postives = 93/120 (77.50%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            PG I  NI++ L ++  PLGI DWNS+FWIAHPGGPAILD VE+          ATR VLSEYGNMSSACVLFI+DEMRK+S E+   TTGEG+DWGVL  FGPGLTV+TVVLHSVP+ A
Sbjct:  273 PGLISKNIERALEDAFKPLGIDDWNSVFWIAHPGGPAILDMVEAKVNLNKERMRATRHVLSEYGNMSSACVLFIMDEMRKRSAEDGHTTTGEGMDWGVLFGFGPGLTVETVVLHSVPVTA 392          

HSP 2 Score: 37.3502 bits (85), Expect = 3.578e-47
Identity = 27/59 (45.76%), Postives = 30/59 (50.85%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGI-LSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +    P      DSL GQ LF  GAA VI  A  D   ER + Q
Sbjct:  184 NRGARVLVVCSEITAVTFRGPHE---FDSLVGQALFGDGAAAVIVGADPDESVERPLFQ 239          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: THS4_VITVI (Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT00005194001 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.578e-47
Identity = 81/116 (69.83%), Postives = 92/116 (79.31%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            P  I  NI+ CL ++  P+GISDWNS+FWIAHPGGPAILD VE+          ATR +LSEYGNMSSACVLFILDEMRKKS++E K TTGEGLDWGVL  FGPGLT++TVVLHSV
Sbjct:  272 PTLISENIENCLTKAFDPIGISDWNSLFWIAHPGGPAILDAVEAKVGLDKQKLKATRHILSEYGNMSSACVLFILDEMRKKSLKEGKTTTGEGLDWGVLFGFGPGLTIETVVLHSV 387          

HSP 2 Score: 38.5058 bits (88), Expect = 3.578e-47
Identity = 26/58 (44.83%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  G+A VI  +  D   ER + Q
Sbjct:  181 NAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDISIERPLFQ 238          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_CHRAE (Chalcone synthase OS=Chrysosplenium americanum GN=CHS PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 7.919e-47
Identity = 83/118 (70.34%), Postives = 92/118 (77.97%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVE-SXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            PG I  NI+K L E+  P+GI+DWNSIFWIAHPGGPAILDQVE            ATR +LSEYGNMSSACVLFILDEMRKKS    +ATTG+GL+WGVL  FGPGLTV+TVVLHSVP
Sbjct:  275 PGLISKNIEKSLIEAFKPIGINDWNSIFWIAHPGGPAILDQVEHKLAPGRRANSRATRHILSEYGNMSSACVLFILDEMRKKSARRREATTGDGLEWGVLFGFGPGLTVETVVLHSVP 392          

HSP 2 Score: 40.817 bits (94), Expect = 7.919e-47
Identity = 26/56 (46.43%), Postives = 30/56 (53.57%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTM 179
            N GARV+ VCSE   +     S   LDSL GQ LF  GAA +I  A  D   ER +
Sbjct:  184 NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGADPDTAIERPL 239          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_DIAMO (Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.285e-46
Identity = 80/118 (67.80%), Postives = 92/118 (77.97%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI   L E+  P+G+SDWN++FWIAHPGGPAILDQVE+          ATR VLS++GNMSSACVLFILDEMRKKS+ +   TTGEGLDWGVL  FGPGLTV+TVVLHSVP+
Sbjct:  272 PGIISKNITNALEEAFSPIGVSDWNNLFWIAHPGGPAILDQVEAKLGLKEEKLAATRNVLSDFGNMSSACVLFILDEMRKKSLRDGATTTGEGLDWGVLFGFGPGLTVETVVLHSVPL 389          

HSP 2 Score: 37.7354 bits (86), Expect = 2.285e-46
Identity = 24/58 (41.38%), Postives = 30/58 (51.72%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   I     +   LDS+ GQ LF  GA  +I  +  D   ER + Q
Sbjct:  181 NKGARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGALIVGSDPDLSIERPLFQ 238          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_GERHY (Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.977e-46
Identity = 81/117 (69.23%), Postives = 92/117 (78.63%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            P  I  NI+K L ++  PL I+DWNSIFWIAHPGGPAILDQVE           A+R VLSEYGNMSSACVLFILDEMRKKS+++ K TTGEGL+WGVL  FGPGLTV+TVVLHS+P
Sbjct:  278 PALIAKNIEKALIQAFSPLNINDWNSIFWIAHPGGPAILDQVEFKLGLREEKLRASRHVLSEYGNMSSACVLFILDEMRKKSIKDGKTTTGEGLEWGVLFGFGPGLTVETVVLHSLP 394          

HSP 2 Score: 37.7354 bits (86), Expect = 2.977e-46
Identity = 25/56 (44.64%), Postives = 30/56 (53.57%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTM 179
            N GARV+ VCSE   +     +   LDSL GQ LF  GAA VI  +  D   ER +
Sbjct:  187 NKGARVLVVCSEITAVTFRGPNEGHLDSLVGQALFGDGAAAVIIGSDPDLSVERPL 242          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSE_IPOPU (Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 2.478e-45
Identity = 82/116 (70.69%), Postives = 89/116 (76.72%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  +I+K L E+  PLGI DWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S +E   TTGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKHIEKSLNEAFQPLGIRDWNSLFWIAHPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          

HSP 2 Score: 39.2762 bits (90), Expect = 2.478e-45
Identity = 26/58 (44.83%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  GAA +I  +  D   ER + Q
Sbjct:  181 NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQ 238          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSE_IPONI (Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 2.478e-45
Identity = 82/116 (70.69%), Postives = 89/116 (76.72%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  +I+K L E+  PLGI DWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S +E   TTGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKHIEKSLNEAFQPLGIHDWNSLFWIAHPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          

HSP 2 Score: 39.2762 bits (90), Expect = 2.478e-45
Identity = 26/58 (44.83%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  GAA +I  +  D   ER + Q
Sbjct:  181 NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQ 238          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_DIACA (Chalcone synthase OS=Dianthus caryophyllus GN=CHS PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.214e-44
Identity = 78/118 (66.10%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI   L ++  P+G+SDWN++FWIAHPGGPAILDQVE+          ATR VLS++GNMSSACVLFILDEMRKKS+ +   TTGEGLDWGVL  FGP LTV+TVVLHSVP+
Sbjct:  272 PGIISKNITNALEDAFSPIGVSDWNNLFWIAHPGGPAILDQVEAKLGLKEEKLAATRNVLSDFGNMSSACVLFILDEMRKKSLRDGATTTGEGLDWGVLFGFGPSLTVETVVLHSVPL 389          

HSP 2 Score: 35.4242 bits (80), Expect = 1.214e-44
Identity = 28/76 (36.84%), Postives = 35/76 (46.05%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQXXXXXXXTMLH*SDHVFD 239
            N  ARV+ VCSE   I     +   LDS+ GQ LF  GA  +I  +  D   ER + Q       T+L  SD   D
Sbjct:  181 NKDARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGALIVGSDPDLSIERPLFQ-MAWAGQTLLPDSDGAID 255          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: ACS4_RUTGR (Probable acridone synthase 4 OS=Ruta graveolens GN=ACS4 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.501e-44
Identity = 78/120 (65.00%), Postives = 91/120 (75.83%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            P     NI   L E+  PLGISDWNSIFWIAHPGGPAILDQ+E           A++ V+SEYGNMSS+CVLF+LDEMR +S+++ K+TTGEGLDWGVL  FGPGLTV+TVVL SVPI A
Sbjct:  272 PALFSANIDTPLVEAFKPLGISDWNSIFWIAHPGGPAILDQIEEKLGLKEDKLRASKHVMSEYGNMSSSCVLFVLDEMRSRSLQDGKSTTGEGLDWGVLFGFGPGLTVETVVLRSVPIEA 391          

HSP 2 Score: 35.4242 bits (80), Expect = 3.501e-44
Identity = 23/56 (41.07%), Postives = 30/56 (53.57%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTM 179
            N G+RV+ VCSE         S   +DSL GQ LF  GAA ++  A  D+  ER +
Sbjct:  181 NKGSRVLVVCSELTAPTFRGPSPDAVDSLVGQALFADGAAALVVGADPDSSIERAL 236          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: ACS2_RUTGR (Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 4.562e-44
Identity = 78/120 (65.00%), Postives = 91/120 (75.83%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            P     NI   L E+  PLGISDWNSIFWIAHPGGPAILDQ+E           A++ V+SEYGNMSS+CVLF+LDEMR KS+++ K+TTGEGLDWGVL  FGPGLTV+TVVL SVP+ A
Sbjct:  272 PALFSANIDTPLVEAFRPLGISDWNSIFWIAHPGGPAILDQIEVKLGLKEDKLRASKHVMSEYGNMSSSCVLFVLDEMRNKSLQDGKSTTGEGLDWGVLFGFGPGLTVETVVLRSVPVEA 391          

HSP 2 Score: 35.4242 bits (80), Expect = 4.562e-44
Identity = 23/56 (41.07%), Postives = 29/56 (51.79%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTM 179
            N G+RV+ VCSE         S   +DSL GQ LF  GAA ++  A  D   ER +
Sbjct:  181 NKGSRVLVVCSELTAPTFRGPSPDAVDSLVGQALFADGAAALVVGADPDTSVERAL 236          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHS1_SECCE3.578e-4767.50Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3... [more]
THS4_VITVI3.578e-4769.83Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT000... [more]
CHSY_CHRAE7.919e-4770.34Chalcone synthase OS=Chrysosplenium americanum GN=... [more]
CHSY_DIAMO2.285e-4667.80Chalcone synthase OS=Dianthus monspessulanus GN=CH... [more]
CHS3_GERHY2.977e-4669.23Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=... [more]
CHSE_IPOPU2.478e-4570.69Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE... [more]
CHSE_IPONI2.478e-4570.69Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV... [more]
CHSY_DIACA1.214e-4466.10Chalcone synthase OS=Dianthus caryophyllus GN=CHS ... [more]
ACS4_RUTGR3.501e-4465.00Probable acridone synthase 4 OS=Ruta graveolens GN... [more]
ACS2_RUTGR4.562e-4465.00Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top