EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSB_PEA (Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.457e-41
Identity = 84/116 (72.41%), Postives = 92/116 (79.31%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISD+NS+FWIAHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMR+KS EE   TTGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKNIEKALVEAFQPLGISDYNSLFWIAHPGGPAILDQVEAKLSLKQRKMQATRHVLSEYGNMSSACVLFILDEMRRKSKEEQLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_SOYBN (Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.457e-41
Identity = 84/118 (71.19%), Postives = 92/118 (77.97%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K L E+  PLGISD+NSIFWIAHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILD+MRKKS+E    TTGEGLDWGVL  FGPGLTV+TVVL SV +
Sbjct:  271 PGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLDWGVLFGFGPGLTVETVVLRSVTL 388          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_CATRO (Chalcone synthase OS=Catharanthus roseus GN=CHS PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 3.209e-41
Identity = 84/118 (71.19%), Postives = 90/118 (76.27%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI K L E+  PLGISDWNSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S  +  +TTGEGL+WGVL  FGPGLTV+TVVLHSV +
Sbjct:  272 PGLISKNIGKALDEAFQPLGISDWNSIFWIAHPGGPAILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASARDGLSTTGEGLEWGVLFGFGPGLTVETVVLHSVNV 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS8_IPOBA (Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DIV PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 3.209e-41
Identity = 82/117 (70.09%), Postives = 89/117 (76.07%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            P  +  NI+KCL E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S      TTGEGL+WGVL  FGPGLT++TVVLHSVP
Sbjct:  271 PSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVP 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_IPOBA (Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF1 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 3.209e-41
Identity = 82/119 (68.91%), Postives = 90/119 (75.63%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIR 648
            P  +   I+KCL E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRK S      TTGEGL+WGVL  FGPGLT++TVVLHSVPI+
Sbjct:  271 PSVVSNKIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIK 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_MEDSA (Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 4.191e-41
Identity = 84/118 (71.19%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG +  NI K L E+  PL ISD+NSIFWIAHPGGPAILDQVE           ATR+VLSEYGNMSSACVLFILDEMRKKSV+    TTGEGLDWGVL  FGPGLT++TVVLHSV I
Sbjct:  272 PGIVSKNIDKALIEAFQPLNISDYNSIFWIAHPGGPAILDQVEEKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSVQAGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSB_SOLTU (Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 5.474e-41
Identity = 83/116 (71.55%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR+VLS YGNMSSACVLFILDEMRK S +E   TTGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSA_PETHY (Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 5.474e-41
Identity = 83/116 (71.55%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLS+YGNMSSACVLFILDEMRK S +E   TTGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS3_CAMSI (Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 5.474e-41
Identity = 83/116 (71.55%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            P  I  N++K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFILDEMRKKS EE   TTGEGL+WGVL  FGPGLTV+TVVLHS+
Sbjct:  272 PRLISMNVEKSLVEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEWGVLFGFGPGLTVETVVLHSL 387          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_SOLLC (Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS1 PE=2 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 5.474e-41
Identity = 83/116 (71.55%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSV 639
            PG I  NI+K L E+  PLGISDWNS+FWIAHPGGPAILDQVE           ATR+VLS YGNMSSACVLFILDEMRK S +E   TTGEGL+WGVL  FGPGLTV+TVVLHSV
Sbjct:  272 PGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKPEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHSB_PEA2.457e-4172.41Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE... [more]
CHS1_SOYBN2.457e-4171.19Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV... [more]
CHSY_CATRO3.209e-4171.19Chalcone synthase OS=Catharanthus roseus GN=CHS PE... [more]
CHS8_IPOBA3.209e-4170.09Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DI... [more]
CHS1_IPOBA3.209e-4168.91Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS1_MEDSA4.191e-4171.19Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=... [more]
CHSB_SOLTU5.474e-4171.55Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B... [more]
CHSA_PETHY5.474e-4171.55Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=... [more]
CHS3_CAMSI5.474e-4171.55Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 P... [more]
CHS1_SOLLC5.474e-4171.55Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top