EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRATM (Elongation factor Tu OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.105e-29
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTD+TG V     +  E  +MVMPGD VKM + LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  307 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAV-----ELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRATH (Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.105e-29
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTD+TG V     +  E  +MVMPGD VKM + LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  307 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAV-----ELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRATF (Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.105e-29
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTD+TG V     +  E  +MVMPGD VKM + LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  307 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAV-----ELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRAT1 (Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.105e-29
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTD+TG V     +  E  +MVMPGD VKM + LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  307 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAV-----ELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SCEOB (Elongation factor Tu, chloroplastic OS=Scenedesmus obliquus GN=tufA PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 7.974e-29
Identity = 60/102 (58.82%), Postives = 78/102 (76.47%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMN---------DKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRHSPF  GY+PQF++RTTDVTG++ S  +          ++  +KM MPGDR+++ V+LI PVA E+GMRFAIREGG+TVGAGV+ +I+E
Sbjct:  317 AQVYVLTKEEGGRHSPFLVGYQPQFFIRTTDVTGKIVSFTHIQMKNPSSVAEEHSNKMAMPGDRIEVTVQLIYPVAVEKGMRFAIREGGRTVGAGVVTNILE 418          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PSEAE (Elongation factor Tu OS=Pseudomonas aeruginosa GN=tufA PE=3 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 7.974e-29
Identity = 62/91 (68.13%), Postives = 70/91 (76.92%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL KEEGGRH+PFF GYRPQFY RTTDVTG       +  E  +MVMPGD +KMVV LI P+A E G+RFAIREGG+TVGAGV+  IIE
Sbjct:  312 VYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNC-----ELPEGVEMVMPGDNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PSEAB (Elongation factor Tu OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 7.974e-29
Identity = 62/91 (68.13%), Postives = 70/91 (76.92%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL KEEGGRH+PFF GYRPQFY RTTDVTG       +  E  +MVMPGD +KMVV LI P+A E G+RFAIREGG+TVGAGV+  IIE
Sbjct:  312 VYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNC-----ELPEGVEMVMPGDNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PSEA7 (Elongation factor Tu OS=Pseudomonas aeruginosa (strain PA7) GN=tuf1 PE=3 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 7.974e-29
Identity = 62/91 (68.13%), Postives = 70/91 (76.92%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL KEEGGRH+PFF GYRPQFY RTTDVTG       +  E  +MVMPGD +KMVV LI P+A E G+RFAIREGG+TVGAGV+  IIE
Sbjct:  312 VYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNC-----ELPEGVEMVMPGDNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PETMO (Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 7.974e-29
Identity = 62/93 (66.67%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRH+PF  GYRPQFY+RT DVTG +    +     ++MVMPGD + M VELI PVA E+GMRFAIREGG+TVGAGV+  IIE
Sbjct:  311 AEVYVLKKEEGGRHTPFTKGYRPQFYIRTADVTGTLVEFSSG----AEMVMPGDNINMTVELIYPVALEEGMRFAIREGGRTVGAGVVTEIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRAP2 (Elongation factor Tu OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 7.974e-29
Identity = 60/93 (64.52%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTD+TG V     +  E  +MVMPGD +KM + LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  307 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAV-----ELPEGVEMVMPGDNIKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE 394          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_FRATM6.105e-2965.59Elongation factor Tu OS=Francisella tularensis sub... [more]
EFTU_FRATH6.105e-2965.59Elongation factor Tu OS=Francisella tularensis sub... [more]
EFTU_FRATF6.105e-2965.59Elongation factor Tu OS=Francisella tularensis sub... [more]
EFTU_FRAT16.105e-2965.59Elongation factor Tu OS=Francisella tularensis sub... [more]
EFTU_SCEOB7.974e-2958.82Elongation factor Tu, chloroplastic OS=Scenedesmus... [more]
EFTU_PSEAE7.974e-2968.13Elongation factor Tu OS=Pseudomonas aeruginosa GN=... [more]
EFTU_PSEAB7.974e-2968.13Elongation factor Tu OS=Pseudomonas aeruginosa (st... [more]
EFTU_PSEA77.974e-2968.13Elongation factor Tu OS=Pseudomonas aeruginosa (st... [more]
EFTU_PETMO7.974e-2966.67Elongation factor Tu OS=Petrotoga mobilis (strain ... [more]
EFTU_FRAP27.974e-2964.52Elongation factor Tu OS=Francisella philomiragia s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top