EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_VIBVY (Elongation factor Tu 2 OS=Vibrio vulnificus (strain YJ016) GN=tuf2 PE=3 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 60/93 (64.52%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL K+EGGRH+PFF GYRPQFY RTTDVTG +S       E  +MVMPGD ++MVVELI P+A ++G+RFAIREGG+TVGAGV+  I E
Sbjct:  307 SEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDISL-----PEGVEMVMPGDNIQMVVELISPIAMDEGLRFAIREGGRTVGAGVVAKIFE 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_VIBCH (Elongation factor Tu-B OS=Vibrio cholerae GN=tufB PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 60/92 (65.22%), Postives = 73/92 (79.35%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL K+EGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD VKMVV+LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGSI-----ELPEGVEMVMPGDNVKMVVDLIAPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_SYNWW (Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain Goettingen) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 61/94 (64.89%), Postives = 73/94 (77.66%), Query Frame = 2
Query:    2 HASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            +A VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +        E  +MVMPGD V+M +ELI P+A E+G+RFAIREGG+TVGAGV+ S+ E
Sbjct:  312 NAEVYVLTKEEGGRHTPFFGGYRPQFYFRTTDVTGIIQL-----PEGVEMVMPGDNVQMAIELITPIAIEEGLRFAIREGGRTVGAGVVTSLNE 400          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_VIBCH (Elongation factor Tu-A OS=Vibrio cholerae GN=tufA PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 60/92 (65.22%), Postives = 73/92 (79.35%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL K+EGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD VKMVV+LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGSI-----ELPEGVEMVMPGDNVKMVVDLIAPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_SYNWW (Elongation factor Tu 1 OS=Syntrophomonas wolfei subsp. wolfei (strain Goettingen) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.041e-28
Identity = 61/94 (64.89%), Postives = 73/94 (77.66%), Query Frame = 2
Query:    2 HASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            +A VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +        E  +MVMPGD V+M +ELI P+A E+G+RFAIREGG+TVGAGV+ S+ E
Sbjct:  312 NAEVYVLTKEEGGRHTPFFGGYRPQFYFRTTDVTGIIQL-----PEGVEMVMPGDNVQMAIELITPIAIEEGLRFAIREGGRTVGAGVVTSLNE 400          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SHEPU (Elongation factor Tu OS=Shewanella putrefaciens GN=tuf PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SHEPC (Elongation factor Tu OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SHEB8 (Elongation factor Tu OS=Shewanella baltica (strain OS185) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KMVV LI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PSEA6 (Elongation factor Tu OS=Pseudoalteromonas atlantica (strain T6c / BAA-1087) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 61/92 (66.30%), Postives = 72/92 (78.26%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVL K+EGGRH+PFF GYRPQFY RTTDVTG V     +  E  +MVMPGD +K VVELI P+A ++G+RFAIREGG+TVGAGV+  II
Sbjct:  307 AEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGAV-----ELPEGVEMVMPGDNLKFVVELIAPIAMDEGLRFAIREGGRTVGAGVVAKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_MANSM (Elongation factor Tu OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 60/93 (64.52%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KM V LI P+A +QG+RFAIREGG+TVGAGV+  II+
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK 394          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU2_VIBVY1.041e-2864.52Elongation factor Tu 2 OS=Vibrio vulnificus (strai... [more]
EFTU2_VIBCH1.041e-2865.22Elongation factor Tu-B OS=Vibrio cholerae GN=tufB ... [more]
EFTU2_SYNWW1.041e-2864.89Elongation factor Tu 2 OS=Syntrophomonas wolfei su... [more]
EFTU1_VIBCH1.041e-2865.22Elongation factor Tu-A OS=Vibrio cholerae GN=tufA ... [more]
EFTU1_SYNWW1.041e-2864.89Elongation factor Tu 1 OS=Syntrophomonas wolfei su... [more]
EFTU_SHEPU1.360e-2865.22Elongation factor Tu OS=Shewanella putrefaciens GN... [more]
EFTU_SHEPC1.360e-2865.22Elongation factor Tu OS=Shewanella putrefaciens (s... [more]
EFTU_SHEB81.360e-2865.22Elongation factor Tu OS=Shewanella baltica (strain... [more]
EFTU_PSEA61.360e-2866.30Elongation factor Tu OS=Pseudoalteromonas atlantic... [more]
EFTU_MANSM1.360e-2864.52Elongation factor Tu OS=Mannheimia succiniciproduc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top