EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROMP (Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.404e-33
Identity = 66/91 (72.53%), Postives = 77/91 (84.62%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGANVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROM2 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.404e-33
Identity = 65/91 (71.43%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIK 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_MESVI (Elongation factor Tu, chloroplastic OS=Mesostigma viride GN=tufA PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.404e-33
Identity = 64/93 (68.82%), Postives = 78/93 (83.87%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D   +++MVMPGDRVKMVV LI P+A E+GMRFAIREGG+TVGAG++  I+E
Sbjct:  318 SEVYVLAKEEGGRHTPFFPGYRPQFYVRTTDVTGKIDSFKADDGSDTQMVMPGDRVKMVVSLIQPIAIEKGMRFAIREGGRTVGAGIVSEILE 410          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROMS (Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.395e-33
Identity = 64/91 (70.33%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKILK 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROM9 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.395e-33
Identity = 64/91 (70.33%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKILK 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROM0 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.395e-33
Identity = 64/91 (70.33%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKILK 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROMA (Elongation factor Tu OS=Prochlorococcus marinus GN=tuf PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.128e-33
Identity = 65/91 (71.43%), Postives = 77/91 (84.62%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGSSVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIK 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROM4 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.128e-33
Identity = 65/91 (71.43%), Postives = 77/91 (84.62%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D     +MVMPGDR+KM  ELI PVA EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIK 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CYACA (Elongation factor Tu, chloroplastic OS=Cyanidium caldarium GN=tufA PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.128e-33
Identity = 64/93 (68.82%), Postives = 76/93 (81.72%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG +S    D    ++MV+PGDR+KM VELI PVA EQGMRFAIREGG+TVGAG++  I++
Sbjct:  318 AEVYVLNKEEGGRHTPFFPGYRPQFYVRTTDVTGNISQFTTDDGGSAEMVLPGDRIKMTVELIHPVAIEQGMRFAIREGGRTVGAGIVSKILD 410          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ACAM1 (Elongation factor Tu OS=Acaryochloris marina (strain MBIC 11017) GN=tuf PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 4.086e-33
Identity = 63/93 (67.74%), Postives = 78/93 (83.87%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VY+LKK+EGGRH+PFF GYRPQFY+RTTDVTG +S+   D    ++MVMPGDR+KM VELI P+A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  317 SEVYILKKDEGGRHTPFFPGYRPQFYVRTTDVTGTISAFTADDGSAAEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_PROMP1.404e-3372.53Elongation factor Tu OS=Prochlorococcus marinus su... [more]
EFTU_PROM21.404e-3371.43Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_MESVI1.404e-3368.82Elongation factor Tu, chloroplastic OS=Mesostigma ... [more]
EFTU_PROMS2.395e-3370.33Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_PROM92.395e-3370.33Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_PROM02.395e-3370.33Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_PROMA3.128e-3371.43Elongation factor Tu OS=Prochlorococcus marinus GN... [more]
EFTU_PROM43.128e-3371.43Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_CYACA3.128e-3368.82Elongation factor Tu, chloroplastic OS=Cyanidium c... [more]
EFTU_ACAM14.086e-3367.74Elongation factor Tu OS=Acaryochloris marina (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top