EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNPX (Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.336e-33
Identity = 65/91 (71.43%), Postives = 76/91 (83.52%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D     +MVMPGDR+KM  ELI PVA E GMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGSAVEMVMPGDRIKMTGELICPVAMENGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNP6 (Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=tuf PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.336e-33
Identity = 63/93 (67.74%), Postives = 77/93 (82.80%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVLKKEEGGRH+PFF GYRPQFY+RTTDVTG +S    D    ++MV+PGDR+KM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  317 SEVYVLKKEEGGRHTPFFPGYRPQFYVRTTDVTGAISDFTADDGSAAEMVIPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILQ 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNE7 (Elongation factor Tu OS=Synechococcus elongatus (strain PCC 7942) GN=tuf PE=3 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 5.336e-33
Identity = 63/93 (67.74%), Postives = 77/93 (82.80%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVLKKEEGGRH+PFF GYRPQFY+RTTDVTG +S    D    ++MV+PGDR+KM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  317 SEVYVLKKEEGGRHTPFFPGYRPQFYVRTTDVTGAISDFTADDGSAAEMVIPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILQ 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_TRIEI (Elongation factor Tu OS=Trichodesmium erythraeum (strain IMS101) GN=tuf PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 6.969e-33
Identity = 64/93 (68.82%), Postives = 76/93 (81.72%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVLKKEEGGRH+PFF  YRPQFY+RTTDVTG + S   D    ++MVMPGDR+KM V+LI PVA EQGMRFAIREGG+T+GAGV+  I+E
Sbjct:  317 SEVYVLKKEEGGRHTPFFPNYRPQFYIRTTDVTGAIESFTADDGSVAEMVMPGDRIKMTVQLINPVAIEQGMRFAIREGGRTIGAGVVSKIVE 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_GLOVI (Elongation factor Tu OS=Gloeobacter violaceus GN=tufA PE=3 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 6.969e-33
Identity = 62/91 (68.13%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VY+L KEEGGRH+PFFAGYRPQFY+RTTDVTG + +  +D+ + ++MVMPGDR+KM VELI P+A E GMRFAIREGG+TVGAGV+  I++
Sbjct:  319 VYILSKEEGGRHTPFFAGYRPQFYVRTTDVTGTIVTFTDDEGKSAEMVMPGDRIKMTVELINPIAIEDGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ASTLO (Elongation factor Tu, plastid OS=Astasia longa GN=tufA PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 6.969e-33
Identity = 62/94 (65.96%), Postives = 80/94 (85.11%), Query Frame = 2
Query:    2 HASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            ++ VY+L KEEGGRH+PFF GY+PQFY+RTTDVTG++ S  +D     +MVMPGD++KM+VEL+ P+A E+GMRFAIREGGKTVGAGVI +II+
Sbjct:  316 NSQVYILTKEEGGRHTPFFEGYKPQFYVRTTDVTGKIESFKSDDGTTVQMVMPGDKIKMIVELVQPIAIEKGMRFAIREGGKTVGAGVIINIID 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CYAME (Elongation factor Tu, chloroplastic OS=Cyanidioschyzon merolae GN=tufA PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.102e-33
Identity = 65/93 (69.89%), Postives = 75/93 (80.65%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG +     D   +++MVMPGDR+KM V LI PVA EQGMRFAIREGG+TVGAGV+  I+E
Sbjct:  318 AEVYVLTKEEGGRHTPFFPGYRPQFYVRTTDVTGTIEDFTADDGSKAEMVMPGDRIKMCVNLIYPVAIEQGMRFAIREGGRTVGAGVVTKILE 410          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNY3 (Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803) GN=tuf PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.189e-32
Identity = 64/91 (70.33%), Postives = 75/91 (82.42%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFA YRPQFY+RTTDVTG + S   D     +MVMPGDR+KM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  309 VYVLKKEEGGRHTPFFANYRPQFYVRTTDVTGTIKSYTADDGSAVEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILK 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PROMM (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.189e-32
Identity = 64/91 (70.33%), Postives = 76/91 (83.52%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD +KM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  309 VYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_GRATL (Elongation factor Tu, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=tufA PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.189e-32
Identity = 63/93 (67.74%), Postives = 76/93 (81.72%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VY+L KEEGGRH+PFF+GYRPQFY+RTTDVTG ++    D    ++MVMPGDR+KM  ELI P+A EQGMRFAIREGG+TVGAGV+  I+E
Sbjct:  317 AEVYILTKEEGGRHTPFFSGYRPQFYVRTTDVTGTITQFTADDGSAAEMVMPGDRIKMSAELINPIAIEQGMRFAIREGGRTVGAGVVSKILE 409          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_SYNPX5.336e-3371.43Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_SYNP65.336e-3367.74Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_SYNE75.336e-3367.74Elongation factor Tu OS=Synechococcus elongatus (s... [more]
EFTU_TRIEI6.969e-3368.82Elongation factor Tu OS=Trichodesmium erythraeum (... [more]
EFTU_GLOVI6.969e-3368.13Elongation factor Tu OS=Gloeobacter violaceus GN=t... [more]
EFTU_ASTLO6.969e-3365.96Elongation factor Tu, plastid OS=Astasia longa GN=... [more]
EFTU_CYAME9.102e-3369.89Elongation factor Tu, chloroplastic OS=Cyanidiosch... [more]
EFTU_SYNY31.189e-3270.33Elongation factor Tu OS=Synechocystis sp. (strain ... [more]
EFTU_PROMM1.189e-3270.33Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_GRATL1.189e-3267.74Elongation factor Tu, chloroplastic OS=Gracilaria ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top