EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRASN (Elongation factor Tu OS=Frankia sp. (strain EAN1pec) GN=tuf PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.463e-27
Identity = 57/93 (61.29%), Postives = 71/93 (76.34%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VY+L K+EGGRH+PFF  YRPQFY RTTDVTG V+       E ++MVMPGD  +M VELI P+A E+G+RFAIREGG+TVGAG +  +I+
Sbjct:  310 ARVYILNKDEGGRHTPFFKNYRPQFYFRTTDVTGVVTL-----PEGTEMVMPGDNTEMTVELIQPIAMEEGLRFAIREGGRTVGAGQVLKVIK 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ENTFA (Elongation factor Tu OS=Enterococcus faecalis GN=tuf PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.463e-27
Identity = 59/93 (63.44%), Postives = 70/93 (75.27%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF  YRPQFY RTTDVTG V     +  E ++MVMPGD V M VELI P+A E G RF+IREGG+TVG+GV+  I++
Sbjct:  308 AEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGVV-----ELPEGTEMVMPGDNVAMDVELIHPIAIEDGTRFSIREGGRTVGSGVVTEIVK 395          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CAMFF (Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.463e-27
Identity = 58/90 (64.44%), Postives = 70/90 (77.78%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            VY+L KEEGGRH+PFF  YRPQFY+RTTDVTG ++       E ++MVMPGD +K+ VELI PVA E G RFAIREGG+TVG+GV+  II
Sbjct:  314 VYILTKEEGGRHTPFFNNYRPQFYVRTTDVTGSITL-----PEGTEMVMPGDNLKITVELINPVALEDGTRFAIREGGRTVGSGVVSKII 398          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_BACHD (Elongation factor Tu OS=Bacillus halodurans GN=tuf PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.463e-27
Identity = 58/91 (63.74%), Postives = 70/91 (76.92%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSI 277
            A VYVL KEEGGRH+PFF+ YRPQFY RTTDVTG +        +  +MVMPGD V+M VELI P+A E+G +F+IREGG+TVGAGV+ SI
Sbjct:  309 AEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIQL-----PDGVEMVMPGDNVEMTVELIAPIAIEEGTKFSIREGGRTVGAGVVASI 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ANADE (Elongation factor Tu OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.463e-27
Identity = 59/93 (63.44%), Postives = 70/93 (75.27%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTDVTG V        +  +MVMPGD + M VELI P+A E+ +RFAIREGG+TVGAGV+  +I+
Sbjct:  309 AEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGSV-----QLPQGVEMVMPGDNIGMEVELITPIAMEKELRFAIREGGRTVGAGVVAEVIQ 396          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ACIAC (Elongation factor Tu OS=Acidovorax avenae subsp. citrulli (strain AAC00-1) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.463e-27
Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVL K+EGGRH+PFF  YRPQFY RTTDVTG +     +   + +MVMPGD V + V+LI P+A E+G+RFAIREGG+TVGAGV+  II
Sbjct:  309 AEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAI-----ELPADKEMVMPGDNVSITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKII 395          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_ACISJ (Elongation factor Tu 2 OS=Acidovorax sp. (strain JS42) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.463e-27
Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVL K+EGGRH+PFF  YRPQFY RTTDVTG +     +   + +MVMPGD V + V+LI P+A E+G+RFAIREGG+TVGAGV+  II
Sbjct:  309 AEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSI-----ELPADKEMVMPGDNVSITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKII 395          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_ACISJ (Elongation factor Tu 1 OS=Acidovorax sp. (strain JS42) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.463e-27
Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVL K+EGGRH+PFF  YRPQFY RTTDVTG +     +   + +MVMPGD V + V+LI P+A E+G+RFAIREGG+TVGAGV+  II
Sbjct:  309 AEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSI-----ELPADKEMVMPGDNVSITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKII 395          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SULDN (Elongation factor Tu OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=tuf PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 9.747e-27
Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A +YVL KEEGGRH+PFF  YRPQFY+RTTDVTG +        E ++MVMPGD V + VELI P+A E+G +FAIREGG+TVGAGV+  I+
Sbjct:  312 AEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGAIYL-----PEGTEMVMPGDNVSITVELIHPIAMEKGTKFAIREGGRTVGAGVVAEIL 398          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_RUBXD (Elongation factor Tu OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 9.747e-27
Identity = 58/93 (62.37%), Postives = 70/93 (75.27%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF+ YRPQFY RTTDVTG +       +E  +MVMPGD   M V+LI P+A ++G+ FAIREGG+TVGAGV+  IIE
Sbjct:  313 AEVYVLSKEEGGRHTPFFSHYRPQFYFRTTDVTGEIF-----LEEGVEMVMPGDNTVMEVQLISPIAMDEGLNFAIREGGRTVGAGVVTQIIE 400          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_FRASN7.463e-2761.29Elongation factor Tu OS=Frankia sp. (strain EAN1pe... [more]
EFTU_ENTFA7.463e-2763.44Elongation factor Tu OS=Enterococcus faecalis GN=t... [more]
EFTU_CAMFF7.463e-2764.44Elongation factor Tu OS=Campylobacter fetus subsp.... [more]
EFTU_BACHD7.463e-2763.74Elongation factor Tu OS=Bacillus halodurans GN=tuf... [more]
EFTU_ANADE7.463e-2763.44Elongation factor Tu OS=Anaeromyxobacter dehalogen... [more]
EFTU_ACIAC7.463e-2761.96Elongation factor Tu OS=Acidovorax avenae subsp. c... [more]
EFTU2_ACISJ7.463e-2761.96Elongation factor Tu 2 OS=Acidovorax sp. (strain J... [more]
EFTU1_ACISJ7.463e-2761.96Elongation factor Tu 1 OS=Acidovorax sp. (strain J... [more]
EFTU_SULDN9.747e-2761.96Elongation factor Tu OS=Sulfurimonas denitrificans... [more]
EFTU_RUBXD9.747e-2762.37Elongation factor Tu OS=Rubrobacter xylanophilus (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top