EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ANAVT (Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.928e-31
Identity = 60/91 (65.93%), Postives = 77/91 (84.62%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG + +  +D+ E  +MVMPGDR+K+ VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  319 VYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKAFTSDEGEAVEMVMPGDRIKVTVELINPIAIEQGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ANASP (Elongation factor Tu OS=Anabaena sp. (strain PCC 7120) GN=tuf PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.928e-31
Identity = 60/91 (65.93%), Postives = 77/91 (84.62%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG + +  +D+ E  +MVMPGDR+K+ VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  319 VYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKAFTSDEGETVEMVMPGDRIKVTVELINPIAIEQGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_THAPS (Elongation factor Tu, chloroplastic OS=Thalassiosira pseudonana GN=tufA PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 3.824e-31
Identity = 61/93 (65.59%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG +     D     +MVMPGDR+KM  ELI PVA E+GMRFAIREGG+T+GAGV+  I++
Sbjct:  317 SEVYVLTKEEGGRHTPFFTGYRPQFYVRTTDVTGSIEQFTADDGTIVEMVMPGDRIKMTAELIYPVAIEEGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_NOSP7 (Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 4.994e-31
Identity = 61/91 (67.03%), Postives = 77/91 (84.62%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG + +  +D+ +E +MVMPGDR+KM VELI  +A EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  319 VYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKAYTSDEGKEVEMVMPGDRIKMTVELINAIAIEQGMRFAIREGGRTIGAGVVSKIIK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_MICAN (Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 4.994e-31
Identity = 62/91 (68.13%), Postives = 72/91 (79.12%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL KEEGGRH+PFF  YRPQFY+RTTDVTG +     D     +MVMPGDR+KM VELI P+A EQGMRFAIREGG+T+G+GVI  II+
Sbjct:  319 VYVLSKEEGGRHTPFFKNYRPQFYVRTTDVTGTIQDYTADDGSTVEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGSGVISKIIK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CYAP7 (Elongation factor Tu OS=Cyanothece sp. (strain PCC 7424) GN=tuf PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 4.994e-31
Identity = 62/91 (68.13%), Postives = 72/91 (79.12%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL KEEGGRH+PFF  YRPQFY+RTTDVTG +     D     +MVMPGDR+KM VELI P+A EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  320 VYVLTKEEGGRHTPFFKNYRPQFYVRTTDVTGTIVDYTADDGSAVEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKIIQ 410          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CYAP4 (Elongation factor Tu OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=tuf PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 4.994e-31
Identity = 61/91 (67.03%), Postives = 75/91 (82.42%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG + S   D    ++MVMPGDR+KM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  319 VYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKSFTADDGSNAEMVMPGDRIKMNVELINPIAIEQGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CYAA5 (Elongation factor Tu OS=Cyanothece sp. (strain ATCC 51142) GN=tuf PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 4.994e-31
Identity = 61/91 (67.03%), Postives = 72/91 (79.12%), Query Frame = 2
Query:   11 VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            VYVL KEEGGRH+PFF  YRPQFY+RTTDVTG +     D     +MVMPGDR+KM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  319 VYVLTKEEGGRHTPFFKNYRPQFYVRTTDVTGTIQDYTADDGSAVEMVMPGDRIKMTVELISPIAIEQGMRFAIREGGRTIGAGVVSKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CHACO (Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 6.523e-31
Identity = 59/88 (67.05%), Postives = 75/88 (85.23%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVI 268
            A VY+L+KEEGGRHSPFFAGYRPQF++RT DVTG + +   D  ++++MVMPGDRVKM+V LI P+A E+ MRFAIREGG+T+GAGV+
Sbjct:  318 AQVYILRKEEGGRHSPFFAGYRPQFFVRTADVTGVIEAFEYDNGDKTRMVMPGDRVKMIVNLICPIAIEKKMRFAIREGGRTIGAGVV 405          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_ROSS1 (Elongation factor Tu 2 OS=Roseiflexus sp. (strain RS-1) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.898e-30
Identity = 62/93 (66.67%), Postives = 78/93 (83.87%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A+VYVLKKEEGGRH+PFF+GYRPQFY+RTTDVTG +        E  +MVMPGD ++M VELI+PVA E+G+RFAIREGG+TVGAGV+ +I++
Sbjct:  314 ANVYVLKKEEGGRHTPFFSGYRPQFYIRTTDVTGAIHL-----PEGVEMVMPGDNIEMTVELIVPVAIEEGLRFAIREGGRTVGAGVVSAIVD 401          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_ANAVT2.928e-3165.93Elongation factor Tu OS=Anabaena variabilis (strai... [more]
EFTU_ANASP2.928e-3165.93Elongation factor Tu OS=Anabaena sp. (strain PCC 7... [more]
EFTU_THAPS3.824e-3165.59Elongation factor Tu, chloroplastic OS=Thalassiosi... [more]
EFTU_NOSP74.994e-3167.03Elongation factor Tu OS=Nostoc punctiforme (strain... [more]
EFTU_MICAN4.994e-3168.13Elongation factor Tu OS=Microcystis aeruginosa (st... [more]
EFTU_CYAP74.994e-3168.13Elongation factor Tu OS=Cyanothece sp. (strain PCC... [more]
EFTU_CYAP44.994e-3167.03Elongation factor Tu OS=Cyanothece sp. (strain PCC... [more]
EFTU_CYAA54.994e-3167.03Elongation factor Tu OS=Cyanothece sp. (strain ATC... [more]
EFTU_CHACO6.523e-3167.05Elongation factor Tu, chloroplastic OS=Chara conni... [more]
EFTU2_ROSS11.898e-3066.67Elongation factor Tu 2 OS=Roseiflexus sp. (strain ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top