EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_ROSS1 (Elongation factor Tu 1 OS=Roseiflexus sp. (strain RS-1) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.898e-30
Identity = 62/93 (66.67%), Postives = 78/93 (83.87%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A+VYVLKKEEGGRH+PFF+GYRPQFY+RTTDVTG +        E  +MVMPGD ++M VELI+PVA E+G+RFAIREGG+TVGAGV+ +I++
Sbjct:  314 ANVYVLKKEEGGRHTPFFSGYRPQFYIRTTDVTGAIHL-----PEGVEMVMPGDNIEMTVELIVPVAIEEGLRFAIREGGRTVGAGVVSAIVD 401          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PHATR (Elongation factor Tu, chloroplastic OS=Phaeodactylum tricornutum GN=tufA PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.479e-30
Identity = 59/93 (63.44%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL K+EGGRH+PFF GYRPQFY+RTTDVTG ++    D     +MVMPGDR+KM  E I PVA E GMRFAIREGG+T+GAGV+  I++
Sbjct:  317 SEVYVLTKDEGGRHTPFFTGYRPQFYVRTTDVTGSITQFTADDGSVVEMVMPGDRIKMTAEFIYPVAIEAGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_HERAU (Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.479e-30
Identity = 63/92 (68.48%), Postives = 75/92 (81.52%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            A VYVLKKEEGGRHSPFF+GYRPQFY+RTTDVTG +        E  +MVMPGD ++M VELI+PVA EQG++FAIREGG+TVGAG++  II
Sbjct:  313 AEVYVLKKEEGGRHSPFFSGYRPQFYVRTTDVTGAIG-----LPEGVEMVMPGDNIQMTVELIVPVAIEQGLKFAIREGGRTVGAGIVPEII 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CODFR (Elongation factor Tu, chloroplastic OS=Codium fragile GN=tufA PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 3.237e-30
Identity = 62/94 (65.96%), Postives = 76/94 (80.85%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDE-ESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VY+LKKEEGGRH+ FFAGYRPQFY+RTTDVTG + +     D  + +MVMPGDR++M VELI P+A E  MRFAIREGGKTVGAGV+ +I++
Sbjct:  316 AQVYILKKEEGGRHTSFFAGYRPQFYVRTTDVTGHIKTFQGKIDNTQIQMVMPGDRIQMEVELIRPIAIETRMRFAIREGGKTVGAGVVTTIVQ 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_ROSCS (Elongation factor Tu 2 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 3.237e-30
Identity = 62/93 (66.67%), Postives = 78/93 (83.87%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A+VYVLKKEEGGRH+PFF GYRPQFY+RTTDVTG +S          +MVMPGD ++M+VELI+PVA E+G+RFAIREGG+TVGAGV+ +I++
Sbjct:  314 ANVYVLKKEEGGRHTPFFPGYRPQFYIRTTDVTGAISLPAG-----VEMVMPGDNIEMLVELIVPVAIEEGLRFAIREGGRTVGAGVVSAIVD 401          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_ROSCS (Elongation factor Tu 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 3.237e-30
Identity = 62/93 (66.67%), Postives = 78/93 (83.87%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A+VYVLKKEEGGRH+PFF GYRPQFY+RTTDVTG +S          +MVMPGD ++M+VELI+PVA E+G+RFAIREGG+TVGAGV+ +I++
Sbjct:  314 ANVYVLKKEEGGRHTPFFPGYRPQFYIRTTDVTGAISLPAG-----VEMVMPGDNIEMLVELIVPVAIEEGLRFAIREGGRTVGAGVVSAIVD 401          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_ALKMQ (Elongation factor Tu 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=tuf2 PE=3 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 9.419e-30
Identity = 63/93 (67.74%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRH+PFF GYRPQFY RTTDVTG +        E  +MVMPGD + M +ELI P+A E+G+RFAIREGG+TVGAGV+ SIIE
Sbjct:  310 AEVYVLKKEEGGRHTPFFDGYRPQFYFRTTDVTGSIKL-----PEGVEMVMPGDNITMEIELISPIATEEGLRFAIREGGRTVGAGVVASIIE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_ALKMQ (Elongation factor Tu 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 9.419e-30
Identity = 63/93 (67.74%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRH+PFF GYRPQFY RTTDVTG +        E  +MVMPGD + M +ELI P+A E+G+RFAIREGG+TVGAGV+ SIIE
Sbjct:  310 AEVYVLKKEEGGRHTPFFDGYRPQFYFRTTDVTGSIKL-----PEGVEMVMPGDNITMEIELISPIATEEGLRFAIREGGRTVGAGVVASIIE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_HALHL (Elongation factor Tu 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.230e-29
Identity = 63/93 (67.74%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL K+EGGRH+PFF GYRPQFY RTTDVTG V+       E ++MVMPGD VKM V+LI P+A E G+RFAIREGG+TVGAGV+  IIE
Sbjct:  309 AEVYVLSKDEGGRHTPFFNGYRPQFYFRTTDVTGTVTL-----PEGTEMVMPGDNVKMTVQLIAPIAMEDGLRFAIREGGRTVGAGVVSKIIE 396          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_MOOTA (Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.741e-29
Identity = 62/94 (65.96%), Postives = 74/94 (78.72%), Query Frame = 2
Query:    2 HASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            +A VYVL KEEGGRH+PFF GYRPQFY RTTDVTG V+       E  +MVMPGD ++M +ELI P+A E+G+RFAIREGG+TVGAGV+  IIE
Sbjct:  312 NAEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVVNL-----PEGVEMVMPGDNIRMTIELITPIAIEEGLRFAIREGGRTVGAGVVTGIIE 400          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU1_ROSS11.898e-3066.67Elongation factor Tu 1 OS=Roseiflexus sp. (strain ... [more]
EFTU_PHATR2.479e-3063.44Elongation factor Tu, chloroplastic OS=Phaeodactyl... [more]
EFTU_HERAU2.479e-3068.48Elongation factor Tu OS=Herpetosiphon aurantiacus ... [more]
EFTU_CODFR3.237e-3065.96Elongation factor Tu, chloroplastic OS=Codium frag... [more]
EFTU2_ROSCS3.237e-3066.67Elongation factor Tu 2 OS=Roseiflexus castenholzii... [more]
EFTU1_ROSCS3.237e-3066.67Elongation factor Tu 1 OS=Roseiflexus castenholzii... [more]
EFTU2_ALKMQ9.419e-3067.74Elongation factor Tu 2 OS=Alkaliphilus metalliredi... [more]
EFTU1_ALKMQ9.419e-3067.74Elongation factor Tu 1 OS=Alkaliphilus metalliredi... [more]
EFTU1_HALHL1.230e-2967.74Elongation factor Tu 1 OS=Halorhodospira halophila... [more]
EFTU_MOOTA2.741e-2965.96Elongation factor Tu OS=Moorella thermoacetica (st... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top