EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PSEMY (Elongation factor Tu OS=Pseudomonas mendocina (strain ymp) GN=tuf PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 63/93 (67.74%), Postives = 71/93 (76.34%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTDVTG       +  E  +MVMPGD +KMVV LI P+A E G+RFAIREGG+TVGAGV+  IIE
Sbjct:  310 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSC-----ELPEGVEMVMPGDNIKMVVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIIE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_KOSOT (Elongation factor Tu OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tuf PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 63/93 (67.74%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A++YVLKKEEGGRH+PF  GYRPQFY+RT DVTG +     D  E  +MVMPGD V M VELI PVA E+GMRFA+REGG+TVGAGV+  IIE
Sbjct:  311 ANIYVLKKEEGGRHTPFTKGYRPQFYIRTADVTGELV----DLPEGVEMVMPGDNVVMTVELIYPVAIEKGMRFAVREGGRTVGAGVVSEIIE 399          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_COXBU (Elongation factor Tu OS=Coxiella burnetii GN=tufA PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 61/93 (65.59%), Postives = 74/93 (79.57%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A +YVL KEEGGRH+PF  GYRPQFY RTTDVTG++ S+     E  +MVMPGD VK+ VELI PVA ++G+RFA+REGG+TVGAGV+  IIE
Sbjct:  309 AEIYVLSKEEGGRHTPFLQGYRPQFYFRTTDVTGQLLSL----PEGIEMVMPGDNVKVTVELIAPVAMDEGLRFAVREGGRTVGAGVVTKIIE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_COXBR (Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 61/93 (65.59%), Postives = 74/93 (79.57%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A +YVL KEEGGRH+PF  GYRPQFY RTTDVTG++ S+     E  +MVMPGD VK+ VELI PVA ++G+RFA+REGG+TVGAGV+  IIE
Sbjct:  309 AEIYVLSKEEGGRHTPFLQGYRPQFYFRTTDVTGQLLSL----PEGIEMVMPGDNVKVTVELIAPVAMDEGLRFAVREGGRTVGAGVVTKIIE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_COXBN (Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 61/93 (65.59%), Postives = 74/93 (79.57%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A +YVL KEEGGRH+PF  GYRPQFY RTTDVTG++ S+     E  +MVMPGD VK+ VELI PVA ++G+RFA+REGG+TVGAGV+  IIE
Sbjct:  309 AEIYVLSKEEGGRHTPFLQGYRPQFYFRTTDVTGQLLSL----PEGIEMVMPGDNVKVTVELIAPVAMDEGLRFAVREGGRTVGAGVVTKIIE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CHLAU (Elongation factor Tu (Fragment) OS=Chloroflexus aurantiacus GN=tuf PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 61/93 (65.59%), Postives = 74/93 (79.57%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRH+PFF+GYRPQFY+RTTDVTG +           +MVMPGD V M +ELI+PVA E+G+RFAIREGG+TVGAGV+  I++
Sbjct:  295 AQVYVLKKEEGGRHTPFFSGYRPQFYIRTTDVTGAIG-----LPAGMEMVMPGDNVVMTIELIVPVAIEEGLRFAIREGGRTVGAGVVTKILD 382          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_CHLAA (Elongation factor Tu OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 61/93 (65.59%), Postives = 74/93 (79.57%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRH+PFF+GYRPQFY+RTTDVTG +           +MVMPGD V M +ELI+PVA E+G+RFAIREGG+TVGAGV+  I++
Sbjct:  314 AQVYVLKKEEGGRHTPFFSGYRPQFYIRTTDVTGAIG-----LPAGMEMVMPGDNVVMTIELIVPVAIEEGLRFAIREGGRTVGAGVVTKILD 401          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_PSEU5 (Elongation factor Tu 2 OS=Pseudomonas stutzeri (strain A1501) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 63/93 (67.74%), Postives = 71/93 (76.34%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTDVTG       +  E  +MVMPGD VKMVV LI P+A E G+RFAIREGG+TVGAGV+  I+E
Sbjct:  310 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSC-----ELPEGVEMVMPGDNVKMVVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIVE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_PSEU5 (Elongation factor Tu 1 OS=Pseudomonas stutzeri (strain A1501) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 63/93 (67.74%), Postives = 71/93 (76.34%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTDVTG       +  E  +MVMPGD VKMVV LI P+A E G+RFAIREGG+TVGAGV+  I+E
Sbjct:  310 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSC-----ELPEGVEMVMPGDNVKMVVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIVE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_VIBPA (Elongation factor Tu OS=Vibrio parahaemolyticus GN=tufA PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.675e-29
Identity = 61/93 (65.59%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +S       E  +MVMPGD ++MVVELI P+A ++G+RFAIREGG+TVGAGV+  I E
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGDISL-----PEGVEMVMPGDNIQMVVELIAPIAMDEGLRFAIREGGRTVGAGVVAKIFE 394          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_PSEMY3.579e-2967.74Elongation factor Tu OS=Pseudomonas mendocina (str... [more]
EFTU_KOSOT3.579e-2967.74Elongation factor Tu OS=Kosmotoga olearia (strain ... [more]
EFTU_COXBU3.579e-2965.59Elongation factor Tu OS=Coxiella burnetii GN=tufA ... [more]
EFTU_COXBR3.579e-2965.59Elongation factor Tu OS=Coxiella burnetii (strain ... [more]
EFTU_COXBN3.579e-2965.59Elongation factor Tu OS=Coxiella burnetii (strain ... [more]
EFTU_CHLAU3.579e-2965.59Elongation factor Tu (Fragment) OS=Chloroflexus au... [more]
EFTU_CHLAA3.579e-2965.59Elongation factor Tu OS=Chloroflexus aurantiacus (... [more]
EFTU2_PSEU53.579e-2967.74Elongation factor Tu 2 OS=Pseudomonas stutzeri (st... [more]
EFTU1_PSEU53.579e-2967.74Elongation factor Tu 1 OS=Pseudomonas stutzeri (st... [more]
EFTU_VIBPA4.675e-2965.59Elongation factor Tu OS=Vibrio parahaemolyticus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top