EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_NITOC (Elongation factor Tu OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.675e-29
Identity = 58/94 (61.70%), Postives = 73/94 (77.66%), Query Frame = 2
Query:    2 HASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            +A VYVL K+EGGRH+PFF GYRPQFY RTTDVTG +     D  +  +MVMPGD ++M V LI P+A E+G+RFA+REGG+TVGAGV+  +IE
Sbjct:  308 YAEVYVLSKDEGGRHTPFFTGYRPQFYFRTTDVTGAI-----DLPDGVEMVMPGDNIQMTVSLIAPIAMEEGLRFAVREGGRTVGAGVVSKVIE 396          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_DESDG (Elongation factor Tu OS=Desulfovibrio desulfuricans (strain G20) GN=tuf PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.675e-29
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF+GYRPQFY RTTD+TG +       +E  +MVMPGD    +VELI PVA EQG+RFAIREGG+TVGAGV+  I+E
Sbjct:  310 AEVYVLSKEEGGRHTPFFSGYRPQFYFRTTDITGIIGL-----EEGVEMVMPGDNATFIVELIHPVAMEQGLRFAIREGGRTVGAGVVSEILE 397          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_BACCN (Elongation factor Tu OS=Bacillus cereus subsp. cytotoxis (strain NVH 391-98) GN=tuf PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.675e-29
Identity = 63/93 (67.74%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFFA YRPQFY RTTDVTG +        E ++MVMPGD V+M VELI PVA E+G +F+IREGG+TVGAGV+ SIIE
Sbjct:  308 AEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGIIQL-----PEGTEMVMPGDNVEMTVELIAPVAVEEGTKFSIREGGRTVGAGVVASIIE 395          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ACTSZ (Elongation factor Tu OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.675e-29
Identity = 61/93 (65.59%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD VKM V LI P+A +QG+RFAIREGG+TVGAGV+ S+I+
Sbjct:  307 SEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNVKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVASVIK 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_HALHL (Elongation factor Tu 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf2 PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.675e-29
Identity = 61/93 (65.59%), Postives = 73/93 (78.49%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL K+EGGRH+PFF GYRPQFY RTTDVTG V+       E ++MVMPGD VKM V+LI P+A E G+RFAIREGG+TVGAGV+  I++
Sbjct:  309 AEVYVLSKDEGGRHTPFFNGYRPQFYFRTTDVTGTVTL-----PEGTEMVMPGDNVKMTVQLIAPIAMEDGLRFAIREGGRTVGAGVVSKILD 396          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_WIGBR (Elongation factor Tu OS=Wigglesworthia glossinidia brevipalpis GN=tuf PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.105e-29
Identity = 60/92 (65.22%), Postives = 74/92 (80.43%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 280
            + VYVLKKEEGGRH+PFF GY+PQFY RTTDVTG V     +  + ++MVMPGD VKM+V+LI P+A + G+RFAIREGGKTVGAG++  II
Sbjct:  307 SEVYVLKKEEGGRHTPFFNGYKPQFYFRTTDVTGSV-----ELQKGTEMVMPGDNVKMLVKLISPIAMDDGLRFAIREGGKTVGAGIVSKII 393          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRATW (Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.105e-29
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTD+TG V     +  E  +MVMPGD VKM + LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  307 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAV-----ELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRATT (Elongation factor Tu OS=Francisella tularensis subsp. tularensis GN=tuf PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.105e-29
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTD+TG V     +  E  +MVMPGD VKM + LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  307 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAV-----ELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRATO (Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.105e-29
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTD+TG V     +  E  +MVMPGD VKM + LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  307 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAV-----ELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE 394          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_FRATN (Elongation factor Tu OS=Francisella tularensis subsp. novicida (strain U112) GN=tuf PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.105e-29
Identity = 61/93 (65.59%), Postives = 72/93 (77.42%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVL KEEGGRH+PFF GYRPQFY RTTD+TG V     +  E  +MVMPGD VKM + LI P+A ++G+RFAIREGG+TVGAGV+  IIE
Sbjct:  307 AEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAV-----ELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE 394          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_NITOC4.675e-2961.70Elongation factor Tu OS=Nitrosococcus oceani (stra... [more]
EFTU_DESDG4.675e-2965.59Elongation factor Tu OS=Desulfovibrio desulfurican... [more]
EFTU_BACCN4.675e-2967.74Elongation factor Tu OS=Bacillus cereus subsp. cyt... [more]
EFTU_ACTSZ4.675e-2965.59Elongation factor Tu OS=Actinobacillus succinogene... [more]
EFTU2_HALHL4.675e-2965.59Elongation factor Tu 2 OS=Halorhodospira halophila... [more]
EFTU_WIGBR6.105e-2965.22Elongation factor Tu OS=Wigglesworthia glossinidia... [more]
EFTU_FRATW6.105e-2965.59Elongation factor Tu OS=Francisella tularensis sub... [more]
EFTU_FRATT6.105e-2965.59Elongation factor Tu OS=Francisella tularensis sub... [more]
EFTU_FRATO6.105e-2965.59Elongation factor Tu OS=Francisella tularensis sub... [more]
EFTU_FRATN6.105e-2965.59Elongation factor Tu OS=Francisella tularensis sub... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top