FK826743

Overview
NameFK826743
Unique NameFK826743
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length251
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2871 contig Csv1_Contig2871:859..1109. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_POPKI (Phenylalanine ammonia-lyase G1 OS=Populus kitakamiensis GN=PALG1 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.104e-17
Identity = 37/50 (74.00%), Postives = 46/50 (92.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG++ LTGEKV SPGE+FDKVFTA+C GK++DP+LECL+EWNGA
Sbjct:  628 KFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGA 677          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_VITVI (Phenylalanine ammonia-lyase (Fragment) OS=Vitis vinifera GN=PAL PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.054e-17
Identity = 38/50 (76.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGEKV SPGE+FDKVFTAMC+GKIIDP+L+CL  WNGA
Sbjct:  362 KFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGA 411          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_IPOBA (Phenylalanine ammonia-lyase OS=Ipomoea batatas GN=PAL PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.054e-17
Identity = 38/50 (76.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVREGLG+  LTGEKV SPGEE DKVFTAMC+G IIDP+LECL+ W+GA
Sbjct:  653 KFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGA 702          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_CAMSI (Phenylalanine ammonia-lyase OS=Camellia sinensis GN=PAL PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.295e-17
Identity = 36/50 (72.00%), Postives = 46/50 (92.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGEKV SPGEEFDKVFTA+C+G++IDP+++CL+EWNGA
Sbjct:  660 KFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGA 709          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_TOBAC (Phenylalanine ammonia-lyase OS=Nicotiana tabacum GN=TPA1 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 6.915e-17
Identity = 39/50 (78.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            RFVR+ LG+  LTGEKV SPGEE DKVFTAMC G+IIDPMLECL+ WNGA
Sbjct:  661 RFVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGA 710          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_TRISU (Phenylalanine ammonia-lyase OS=Trifolium subterraneum GN=PAL1 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.032e-17
Identity = 38/50 (76.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG++ LTGE+V SPGEE DK+FTAMCQGKIIDP+L+CL EWNGA
Sbjct:  671 KFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLKCLGEWNGA 720          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_PEA (Phenylalanine ammonia-lyase 2 OS=Pisum sativum GN=PAL2 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.032e-17
Identity = 38/50 (76.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG++ LTGEKV SPGEE DK+FTA+CQGKIIDP+LECL +WNGA
Sbjct:  670 KFVREELGTSLLTGEKVISPGEECDKLFTAICQGKIIDPLLECLGDWNGA 719          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL3_TOBAC (Phenylalanine ammonia-lyase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.180e-16
Identity = 39/50 (78.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            RFVRE LG+  LTGEKV SPGEE DKVFTAMC G+IID +LECL+EWNGA
Sbjct:  658 RFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGA 707          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_BROFI (Phenylalanine ammonia-lyase OS=Bromheadia finlaysoniana GN=PAL PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.541e-16
Identity = 38/50 (76.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FV+E +GS FLTGEKV SPGEEFDKVF A+C+GK IDPML+CL+EWNGA
Sbjct:  650 KFVKE-VGSGFLTGEKVVSPGEEFDKVFNAICEGKAIDPMLDCLKEWNGA 698          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_MEDSA (Phenylalanine ammonia-lyase OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.012e-16
Identity = 38/50 (76.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGE V SPGEE DK+F+AMCQGKIIDP+LECL EWNGA
Sbjct:  671 KFVREELGTGLLTGENVISPGEECDKLFSAMCQGKIIDPLLECLGEWNGA 720          
The following BLAST results are available for this feature:
BLAST of FK826743 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
PAL1_POPKI3.104e-1774.00Phenylalanine ammonia-lyase G1 OS=Populus kitakami... [more]
PALY_VITVI4.054e-1776.00Phenylalanine ammonia-lyase (Fragment) OS=Vitis vi... [more]
PAL1_IPOBA4.054e-1776.00Phenylalanine ammonia-lyase OS=Ipomoea batatas GN=... [more]
PALY_CAMSI5.295e-1772.00Phenylalanine ammonia-lyase OS=Camellia sinensis G... [more]
PAL1_TOBAC6.915e-1778.00Phenylalanine ammonia-lyase OS=Nicotiana tabacum G... [more]
PALY_TRISU9.032e-1776.00Phenylalanine ammonia-lyase OS=Trifolium subterran... [more]
PAL2_PEA9.032e-1776.00Phenylalanine ammonia-lyase 2 OS=Pisum sativum GN=... [more]
PAL3_TOBAC1.180e-1678.00Phenylalanine ammonia-lyase OS=Nicotiana tabacum P... [more]
PALY_BROFI1.541e-1676.00Phenylalanine ammonia-lyase OS=Bromheadia finlayso... [more]
PALY_MEDSA2.012e-1676.00Phenylalanine ammonia-lyase OS=Medicago sativa PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone566 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 566, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826743 ID=FK826743|Name=FK826743|organism=Citrus sinensis|type=EST|length=251bp
ACAGGTTCGTGAGGGAGGGGCTCGGGTCTAATTTTCTAACAGGGGAAAAA
GTTACATCGCCCGGCGAGGAATTTGACAAAGTTTTTACCGCAATGTGCCA
GGGCAAGATCATTGATCCAATGCTGGAATGTCTCAGGGAATGGAATGGCG
CCCCTCTTCCAATTTGTTAGTTGTTTTTATTTTGTTTAATAACACGGTCT
TCAATCCCTTGTGTTCTTGTGTTCATAGAATTTGCCCATGCGAGTCAGTG
G
back to top