FK826743

Overview
NameFK826743
Unique NameFK826743
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length251
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2871 contig Csv1_Contig2871:859..1109. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_PRUAV (Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=PAL1 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.628e-16
Identity = 37/50 (74.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+ +LTGEKV SPGEE DKVFTA+C+GKIIDP+L+CL  WNGA
Sbjct:  663 KFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGA 712          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_PEA (Phenylalanine ammonia-lyase 1 OS=Pisum sativum GN=PAL1 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.628e-16
Identity = 37/50 (74.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            RFVR+ LG+  LTGEKV SPGEE DK+FTA+CQGKIIDP+L+CL +WNGA
Sbjct:  669 RFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGA 718          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL3_PETCR (Phenylalanine ammonia-lyase 3 OS=Petroselinum crispum GN=PAL3 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.432e-16
Identity = 37/50 (74.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+ +LTGEKV SPGEEF+KVFTAM +G+IIDP+LECL  WNGA
Sbjct:  664 KFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNGA 713          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_CICAR (Phenylalanine ammonia-lyase 2 OS=Cicer arietinum GN=PAL2 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.432e-16
Identity = 35/50 (70.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG++ LTGEK+ SPGEE DKVF A+C G+ IDPML+CL+EWNGA
Sbjct:  664 KFVRENLGTSLLTGEKIRSPGEECDKVFAALCDGRFIDPMLDCLKEWNGA 713          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_LITER (Phenylalanine ammonia-lyase 1 OS=Lithospermum erythrorhizon PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.432e-16
Identity = 36/50 (72.00%), Postives = 42/50 (84.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGEKV SPGEE DKVFTAMC+GK++DP+L CL  WNGA
Sbjct:  656 KFVREELGTELLTGEKVRSPGEELDKVFTAMCEGKLVDPLLACLEAWNGA 705          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_DAUCA (Phenylalanine ammonia-lyase 1 OS=Daucus carota GN=PAL1 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.432e-16
Identity = 37/50 (74.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +F+RE LG+ +LTGEKVTSPGEEFDKVFTAM +G+IIDP+L CL  WNGA
Sbjct:  654 KFIREELGTVYLTGEKVTSPGEEFDKVFTAMSKGEIIDPLLACLESWNGA 703          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_SOLLC (Phenylalanine ammonia-lyase OS=Solanum lycopersicum GN=PAL PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.482e-16
Identity = 37/50 (74.00%), Postives = 42/50 (84.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            R VRE LG+  LTGEKV SPGEE DKVFTA+C G+IIDP+LECL+ WNGA
Sbjct:  650 RLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGA 699          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_TOBAC (Phenylalanine ammonia-lyase OS=Nicotiana tabacum GN=PALA PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 7.646e-16
Identity = 38/50 (76.00%), Postives = 42/50 (84.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            RFVR  LG+  LTGEKV SPGEE DKVFTAMC G+IID +LECL+EWNGA
Sbjct:  658 RFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGA 707          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_PETCR (Phenylalanine ammonia-lyase 2 OS=Petroselinum crispum GN=PAL2 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.646e-16
Identity = 37/50 (74.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVR+ LG  +LTGEKVTSPGEEFDKVF AM +G+IIDP+LECL  WNGA
Sbjct:  662 KFVRKELGIEYLTGEKVTSPGEEFDKVFIAMSKGEIIDPLLECLESWNGA 711          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_PETCR (Phenylalanine ammonia-lyase 1 OS=Petroselinum crispum GN=PAL1 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 9.986e-16
Identity = 36/50 (72.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVR+ LG+ +LTGEKVTSPGEEF+KVF AM +G+IIDP+LECL  WNGA
Sbjct:  662 KFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGA 711          
The following BLAST results are available for this feature:
BLAST of FK826743 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
PAL1_PRUAV2.628e-1674.00Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=P... [more]
PAL1_PEA2.628e-1674.00Phenylalanine ammonia-lyase 1 OS=Pisum sativum GN=... [more]
PAL3_PETCR3.432e-1674.00Phenylalanine ammonia-lyase 3 OS=Petroselinum cris... [more]
PAL2_CICAR3.432e-1670.00Phenylalanine ammonia-lyase 2 OS=Cicer arietinum G... [more]
PAL1_LITER3.432e-1672.00Phenylalanine ammonia-lyase 1 OS=Lithospermum eryt... [more]
PAL1_DAUCA3.432e-1674.00Phenylalanine ammonia-lyase 1 OS=Daucus carota GN=... [more]
PAL1_SOLLC4.482e-1674.00Phenylalanine ammonia-lyase OS=Solanum lycopersicu... [more]
PAL2_TOBAC7.646e-1676.00Phenylalanine ammonia-lyase OS=Nicotiana tabacum G... [more]
PAL2_PETCR7.646e-1674.00Phenylalanine ammonia-lyase 2 OS=Petroselinum cris... [more]
PAL1_PETCR9.986e-1672.00Phenylalanine ammonia-lyase 1 OS=Petroselinum cris... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone566 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 566, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826743 ID=FK826743|Name=FK826743|organism=Citrus sinensis|type=EST|length=251bp
ACAGGTTCGTGAGGGAGGGGCTCGGGTCTAATTTTCTAACAGGGGAAAAA
GTTACATCGCCCGGCGAGGAATTTGACAAAGTTTTTACCGCAATGTGCCA
GGGCAAGATCATTGATCCAATGCTGGAATGTCTCAGGGAATGGAATGGCG
CCCCTCTTCCAATTTGTTAGTTGTTTTTATTTTGTTTAATAACACGGTCT
TCAATCCCTTGTGTTCTTGTGTTCATAGAATTTGCCCATGCGAGTCAGTG
G
back to top