FK826743

Overview
NameFK826743
Unique NameFK826743
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length251
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2871 contig Csv1_Contig2871:859..1109. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_RUBID (Phenylalanine ammonia-lyase 1 OS=Rubus idaeus GN=PAL1 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.703e-15
Identity = 35/50 (70.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            RFVRE LG++ LTGEK+ SPGEE  KVF A+C GK++DP+LECL+EWNGA
Sbjct:  656 RFVREELGTSLLTGEKIKSPGEECYKVFNAICAGKLVDPLLECLKEWNGA 705          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_MALDO (Phenylalanine ammonia-lyase (Fragment) OS=Malus domestica GN=PAL PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.225e-15
Identity = 37/50 (74.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG  +LTGEKV SPGEE DKVF A+CQGKIIDP+L CL  WNGA
Sbjct:  181 KFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGA 230          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL5_SOLLC (Phenylalanine ammonia-lyase OS=Solanum lycopersicum GN=PAL5 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.905e-15
Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            R VR+ +G+  LTGEKV SPGEE DKVFTA C G+IIDP+LECL+ WNGA
Sbjct:  667 RLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGA 716          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_DIGLA (Phenylalanine ammonia-lyase OS=Digitalis lanata PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.795e-15
Identity = 35/50 (70.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +F+RE LG+NFLTGEKV SPGEE D+VFTAM +G I+DP+L+CL  WNGA
Sbjct:  659 KFIREELGTNFLTGEKVMSPGEECDRVFTAMSKGLIVDPLLKCLEGWNGA 708          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL3_PHAVU (Phenylalanine ammonia-lyase class 3 OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.473e-15
Identity = 35/49 (71.43%), Postives = 40/49 (81.63%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNG 149
            +FVRE LG   LTGEK  SP EEF+KV+TAMCQ KIIDP+LECL +WNG
Sbjct:  657 KFVREELGIRLLTGEKALSPDEEFEKVYTAMCQAKIIDPILECLEDWNG 705          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_SOLTU (Phenylalanine ammonia-lyase 1 OS=Solanum tuberosum GN=PAL-1 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.473e-15
Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            R VR+ LG+  LTGEKV SPGEE +KVFTAMC G+I DP+LECL+ WNGA
Sbjct:  666 RLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQINDPLLECLKSWNGA 715          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL4_ARATH (Phenylalanine ammonia-lyase 4 OS=Arabidopsis thaliana GN=PAL4 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.454e-15
Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            RFVR+ L +  LTGE V SPGEEFDKVF A+  GK+IDP+LECL+EWNGA
Sbjct:  653 RFVRDELNTELLTGENVRSPGEEFDKVFLAISDGKLIDPLLECLKEWNGA 702          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL4_POPKI (Phenylalanine ammonia-lyase G4 (Fragment) OS=Populus kitakamiensis GN=PALG4 PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.442e-14
Identity = 36/50 (72.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGEKV SPGEEFDKVFTA+C GK+IDP    L+EWNGA
Sbjct:  517 KFVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGA 566          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_IPOBA (Phenylalanine ammonia-lyase OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.883e-14
Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGEKV SPGE  DKVFTA+C G IIDP+LECL+ W+GA
Sbjct:  654 KFVREELGTEMLTGEKVKSPGEVCDKVFTAVCDGGIIDPLLECLKSWDGA 703          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_ORYSJ (Phenylalanine ammonia-lyase OS=Oryza sativa subsp. japonica GN=PAL PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 2.460e-14
Identity = 35/49 (71.43%), Postives = 41/49 (83.67%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNG 149
            RFVRE LG  FLTGEK+ SPGEE +KVF  + QGK+IDPML+CL+EWNG
Sbjct:  647 RFVREELGCVFLTGEKLKSPGEECNKVFLGISQGKLIDPMLDCLKEWNG 695          
The following BLAST results are available for this feature:
BLAST of FK826743 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
PAL1_RUBID1.703e-1570.00Phenylalanine ammonia-lyase 1 OS=Rubus idaeus GN=P... [more]
PALY_MALDO2.225e-1574.00Phenylalanine ammonia-lyase (Fragment) OS=Malus do... [more]
PAL5_SOLLC2.905e-1570.00Phenylalanine ammonia-lyase OS=Solanum lycopersicu... [more]
PALY_DIGLA3.795e-1570.00Phenylalanine ammonia-lyase OS=Digitalis lanata PE... [more]
PAL3_PHAVU6.473e-1571.43Phenylalanine ammonia-lyase class 3 OS=Phaseolus v... [more]
PAL1_SOLTU6.473e-1570.00Phenylalanine ammonia-lyase 1 OS=Solanum tuberosum... [more]
PAL4_ARATH8.454e-1570.00Phenylalanine ammonia-lyase 4 OS=Arabidopsis thali... [more]
PAL4_POPKI1.442e-1472.00Phenylalanine ammonia-lyase G4 (Fragment) OS=Popul... [more]
PAL2_IPOBA1.883e-1470.00Phenylalanine ammonia-lyase OS=Ipomoea batatas PE=... [more]
PAL1_ORYSJ2.460e-1471.43Phenylalanine ammonia-lyase OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone566 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 566, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826743 ID=FK826743|Name=FK826743|organism=Citrus sinensis|type=EST|length=251bp
ACAGGTTCGTGAGGGAGGGGCTCGGGTCTAATTTTCTAACAGGGGAAAAA
GTTACATCGCCCGGCGAGGAATTTGACAAAGTTTTTACCGCAATGTGCCA
GGGCAAGATCATTGATCCAATGCTGGAATGTCTCAGGGAATGGAATGGCG
CCCCTCTTCCAATTTGTTAGTTGTTTTTATTTTGTTTAATAACACGGTCT
TCAATCCCTTGTGTTCTTGTGTTCATAGAATTTGCCCATGCGAGTCAGTG
G
back to top