FK826743

Overview
NameFK826743
Unique NameFK826743
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length251
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2871 contig Csv1_Contig2871:859..1109. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_WHEAT (Phenylalanine ammonia-lyase OS=Triticum aestivum GN=PAL PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.479e-14
Identity = 35/49 (71.43%), Postives = 40/49 (81.63%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNG 149
            RFVR+ LG+ +LTGEK  SPGEE DKVF AM QGK ID +LECL+EWNG
Sbjct:  646 RFVRKELGTEYLTGEKTRSPGEEVDKVFVAMNQGKHIDALLECLKEWNG 694          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL3_ARATH (Phenylalanine ammonia-lyase 3 OS=Arabidopsis thaliana GN=PAL3 PE=1 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 5.479e-14
Identity = 34/50 (68.00%), Postives = 40/50 (80.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            RFVR  L +  LTGE V SPGE+FDKVF A+ QGK+IDP+ ECL+EWNGA
Sbjct:  640 RFVRNELETRLLTGEDVRSPGEDFDKVFRAISQGKLIDPLFECLKEWNGA 689          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_LITER (Phenylalanine ammonia-lyase 2 OS=Lithospermum erythrorhizon PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.479e-14
Identity = 32/50 (64.00%), Postives = 40/50 (80.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVR  LG+  LTGEKV SPGEE D+VF A+C+GK++DP+L CL  WNGA
Sbjct:  651 KFVRGELGTELLTGEKVRSPGEELDQVFNALCEGKLVDPLLACLEAWNGA 700          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_ORYSJ (Phenylalanine ammonia-lyase OS=Oryza sativa subsp. japonica GN=ZB8 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.082e-13
Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNG 149
            RFVRE LG+ +LTGEK  SPGEE +KV  A+ +GK IDP+LECL+EWNG
Sbjct:  659 RFVREELGTKYLTGEKTRSPGEELNKVLVAINEGKHIDPLLECLKEWNG 707          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_ORYSI (Phenylalanine ammonia-lyase OS=Oryza sativa subsp. indica GN=ZB8 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.082e-13
Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNG 149
            RFVRE LG+ +LTGEK  SPGEE +KV  A+ +GK IDP+LECL+EWNG
Sbjct:  659 RFVREELGTKYLTGEKTRSPGEELNKVLVAINEGKHIDPLLECLKEWNG 707          
The following BLAST results are available for this feature:
BLAST of FK826743 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
PALY_WHEAT5.479e-1471.43Phenylalanine ammonia-lyase OS=Triticum aestivum G... [more]
PAL3_ARATH5.479e-1468.00Phenylalanine ammonia-lyase 3 OS=Arabidopsis thali... [more]
PAL2_LITER5.479e-1464.00Phenylalanine ammonia-lyase 2 OS=Lithospermum eryt... [more]
PAL2_ORYSJ2.082e-1367.35Phenylalanine ammonia-lyase OS=Oryza sativa subsp.... [more]
PAL2_ORYSI2.082e-1367.35Phenylalanine ammonia-lyase OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone566 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 566, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826743 ID=FK826743|Name=FK826743|organism=Citrus sinensis|type=EST|length=251bp
ACAGGTTCGTGAGGGAGGGGCTCGGGTCTAATTTTCTAACAGGGGAAAAA
GTTACATCGCCCGGCGAGGAATTTGACAAAGTTTTTACCGCAATGTGCCA
GGGCAAGATCATTGATCCAATGCTGGAATGTCTCAGGGAATGGAATGGCG
CCCCTCTTCCAATTTGTTAGTTGTTTTTATTTTGTTTAATAACACGGTCT
TCAATCCCTTGTGTTCTTGTGTTCATAGAATTTGCCCATGCGAGTCAGTG
G
back to top