EY660295

Overview
NameEY660295
Unique NameEY660295
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length897
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7550 contig Csv1_Contig7550:1..898. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME6_ARATH (Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana GN=PME6 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.621e-48
Identity = 99/220 (45.00%), Postives = 147/220 (66.82%), Query Frame = 1
Query:  220 FPNWVSAKNRKLLQAPRINA--NVIVAQDGTGNYRTVSEAISAAS-----GNRFVIYVKAGVYKEKIRTNKD--GITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNTASLFRT 849
            FP+W    +RKLL+  +  A  +++VA+DG+G+Y ++ +A++AA+       R VIYVKAGVY+E +   K    + +IGDG  +TI+TG+ N + GT+   +ATF ++G+GFIA+ I F NTAGP+  QA+AL  +SD +VFY CS  GYQDTLY  + RQF R+ +IYGT+DFIFG+A A  QNC +  R+P  G  + ITA  + +P + T  + ++
Sbjct:  228 FPSWFPLSDRKLLEDSKTTAKADLVVAKDGSGHYTSIQQAVNAAAKLPRRNQRLVIYVKAGVYRENVVIKKSIKNVMVIGDGIDSTIVTGNRNVQDGTTTFRSATFAVSGNGFIAQGITFENTAGPEKHQAVALRSSSDFSVFYACSFKGYQDTLYLHSSRQFLRNCNIYGTVDFIFGDATAILQNCNIYARKPMSGQKNTITAQSRKEPDETTGFVIQS 447          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME45_ARATH (Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana GN=PME45 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 3.333e-48
Identity = 109/270 (40.37%), Postives = 156/270 (57.78%), Query Frame = 1
Query:   67 ERNEVTENI*KKMDYLSQLTSNPLALVNRIAR--ASYPKNSTY----NRRLDEEQGDFPNWVSAKNRKLLQAPRINA---NVIVAQDGTGNYRTVSEAISAASGN---RFVIYVKAGVYKEK--IRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNT 831
            E  ++   I K  +    LTSN LA++  +    +S PK  T      R   +E     +W+S K R++L+A  + A   N  VA+DG+GN+ T++ A+ A       R+ IY+K G+Y E   I   K  +T++GDG   TI+TG+ +  +      TATF   G+GF+A+ +GF NTAGP+G QA+A+ V SD +VF  C   GYQDTLYA   RQ+YR   I GT+DFIFG+AAA FQNC + +R+   G  + +TA G+ D  Q T
Sbjct:  216 EEGKLKTEIRKNFNSSQVLTSNSLAMIKSLDGYLSSVPKVKTRLLLEARSSAKETDHITSWLSNKERRMLKAVDVKALKPNATVAKDGSGNFTTINAALKAMPAKYQGRYTIYIKHGIYDESVIIDKKKPNVTMVGDGSQKTIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSVFLNCRFEGYQDTLYAYTHRQYYRSCVIIGTVDFIFGDAAAIFQNCDIFIRKGLPGQKNTVTAQGRVDKFQTT 485          

HSP 2 Score: 23.8682 bits (50), Expect = 3.333e-48
Identity = 9/19 (47.37%), Postives = 10/19 (52.63%), Query Frame = 3
Query:  831 GFSFQNCKIAAGSDYAPVK 887
            GF   NC +A   D  PVK
Sbjct:  486 GFVIHNCTVAPNEDLKPVK 504          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME46_ARATH (Probable pectinesterase/pectinesterase inhibitor 46 OS=Arabidopsis thaliana GN=PME46 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.699e-47
Identity = 108/251 (43.03%), Postives = 157/251 (62.55%), Query Frame = 1
Query:  115 SQLTSNPLALVNRIARASYPKNSTYNRRLDEEQGDFPNWVS----AKNRKLLQAPRIN--ANVIVAQDGTGNYRTVSEAISAASGNR---FVIYVKAGVYKEKIRTNKD--GITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNT 831
            +++TSN LA++  + + +      + RR   E G+    V+     + R+LL++  +   A ++VA+DG+G YRT+ EA++          +IYVK GVY E +R  K    + ++GDG+  TI++   N   GT    TATF + G GF+ARD+GF NTAGP   QA+AL V++D +VFY+C++  +QDT+YA A RQFYRD  I GT+DFIFGNAA  FQ C ++ RRP +G  + ITA G+ DP QNT
Sbjct:  198 TEMTSNALAIITWLGKIA--DTVKFRRRRLLETGNAKVVVADLPMMEGRRLLESGDLKKKATIVVAKDGSGKYRTIGEALAEVEEKNEKPTIIYVKKGVYLENVRVEKTKWNVVMVGDGQSKTIVSAGLNFIDGTPTFETATFAVFGKGFMARDMGFINTAGPAKHQAVALMVSADLSVFYKCTMDAFQDTMYAHAQRQFYRDCVILGTVDFIFGNAAVVFQKCEILPRRPMKGQQNTITAQGRKDPNQNT 446          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME12_ARATH (Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana GN=PME12 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.699e-47
Identity = 114/260 (43.85%), Postives = 154/260 (59.23%), Query Frame = 1
Query:  127 SNPLALVNRIARASYPKN--STYNRRLDEEQGDFPNWVSAKNRKLLQAPRI-------NANVIVAQDGTGNYRTVSEAISAA---SGNRFVIYVKAGVYKEKIRTN--KDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNTASLFRTVKLL 861
            SN L+ + +  R + PK   +T NRRL    G FP+WV  K+ + L+           + +++VA DGTGN+ T++EAIS A   S +R +IYVK GVY E I     K  I LIGDG   T ITG+ +   G +   +AT  ++G+GF+ARDI   NTAGP+  QA+AL V +D    YRC I GYQDTLY  + RQFYR+ DIYGTID+IFGNAA  FQ C +V + P  G +  ITA  +    ++T    +   +L
Sbjct:  180 SNSLSALPKQRRTTNPKTGGNTKNRRL---LGLFPDWVYKKDHRFLEDSSDGYDEYDPSESLVVAADGTGNFSTINEAISFAPNMSNDRVLIYVKEGVYDENIDIPIYKTNIVLIGDGSDVTFITGNRSVGDGWTTFRSATLAVSGEGFLARDIMITNTAGPEKHQAVALRVNADFVALYRCVIDGYQDTLYTHSFRQFYRECDIYGTIDYIFGNAAVVFQGCNIVSKLPMPGQFTVITAQSRDTQDEDTGISMQNCSIL 436          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME13_ARATH (Probable pectinesterase/pectinesterase inhibitor 13 OS=Arabidopsis thaliana GN=PME13 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 2.219e-47
Identity = 104/255 (40.78%), Postives = 151/255 (59.22%), Query Frame = 1
Query:  121 LTSNPLALVNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAPRINA---NVIVAQDGTGNYRTVSEAISAASGN---RFVIYVKAGVYKEKIRTNKD--GITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNTASLFRTVKL 858
            LTSN LAL+        P      R L +     P+WVS  +R++L+A  + A   N  VA+DG+G++ T+++A+ A       R++IYVK G+Y E +  +K    +T++GDG   TI+TG+ +  +      TATF   G+GF+A+ +GF NTAG +G QA+A+ V SD ++F  C   GYQDTLYA   RQ+YR   I GTIDFIFG+AAA FQNC + +R+   G  + +TA G+ D  Q T  +    K+
Sbjct:  248 LTSNSLALIKTFTENLSPVMKVVERHLLD---GIPSWVSNDDRRMLRAVDVKALKPNATVAKDGSGDFTTINDALRAMPEKYEGRYIIYVKQGIYDEYVTVDKKKANLTMVGDGSQKTIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTAGSEGHQAVAIRVQSDRSIFLNCRFEGYQDTLYAYTHRQYYRSCVIVGTIDFIFGDAAAIFQNCNIFIRKGLPGQKNTVTAQGRVDKFQTTGFVVHNCKI 499          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME24_ARATH (Putative pectinesterase/pectinesterase inhibitor 24 OS=Arabidopsis thaliana GN=PME24 PE=3 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.898e-47
Identity = 109/250 (43.60%), Postives = 157/250 (62.80%), Query Frame = 1
Query:  115 SQLTSNPLALVNRIARASYPKNSTYNRRL---DEEQGDFPNWVSAKNRKLLQAPRIN--ANVIVAQDGTGNYRTVSEAISAA---SGNRFVIYVKAGVYKEKIRTNKD--GITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNT 831
            ++LTSN LA++  + + +   +    RRL    + + DF        R+LLQ+  +   A+++VA+DG+G YRT+  A+      S  R +IYVK GVY E ++  K    + ++GDG+  +I++G  N   GT    TATF + G GF+ARD+GF NTAGP   QA+AL V++D T FYRC++  YQDTLY  A RQFYR+  I GT+DFIFGN+A+  Q+C ++ RRP +G  + ITA G+TDP  NT
Sbjct:  202 TELTSNALAIITWLGKIA--DSFKLRRRLLTTADVEVDFH-----AGRRLLQSTDLRKVADIVVAKDGSGKYRTIKRALQDVPEKSEKRTIIYVKKGVYFENVKVEKKMWNVIVVGDGESKSIVSGRLNVIDGTPTFKTATFAVFGKGFMARDMGFINTAGPSKHQAVALMVSADLTAFYRCTMNAYQDTLYVHAQRQFYRECTIIGTVDFIFGNSASVLQSCRILPRRPMKGQQNTITAQGRTDPNMNT 444          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME39_ARATH (Probable pectinesterase/pectinesterase inhibitor 39 OS=Arabidopsis thaliana GN=PME39 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 3.785e-47
Identity = 115/277 (41.52%), Postives = 159/277 (57.40%), Query Frame = 1
Query:   76 EVTENI*KKMDYLSQLTSNPLALVNRIARAS-YPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAA---SGNRFVIYVKAGVYKEKIRT--NKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRPE-GSYHAITANGKTDPGQNTASLFRTVKLLRAPTML 879
            E+ EN+ + +  +S   SN L ++  I+R    PK+S       E   ++P+W+S  +++LL+AP    N N+ VA DGTGN+ T+++A+ AA   S  RF+IY+K G Y E +     K  I  IGDG   T+I  + +   G S   T T  + G G+IA+DI F N+AGP   QA+A    SDH+ FYRC   GYQDTLY  + +QFYR+ DIYGTIDFIFGNAA  FQN  L  R+P  G   A TA  +    Q T       ++L AP ++
Sbjct:  157 ELPENLKEIILDISNNLSNSLHMLQVISRKKPSPKSS-------EVDVEYPSWLSENDQRLLEAPVQETNYNLSVAIDGTGNFTTINDAVFAAPNMSETRFIIYIKGGEYFENVELPKKKTMIMFIGDGIGKTVIKANRSRIDGWSTFQTPTVGVKGKGYIAKDISFVNSAGPAKAQAVAFRSGSDHSAFYRCEFDGYQDTLYVHSAKQFYRECDIYGTIDFIFGNAAVVFQNSSLYARKPNPGHKIAFTAQSRNQSDQPTGISILNCRILAAPDLI 426          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME40_ARATH (Probable pectinesterase/pectinesterase inhibitor 40 OS=Arabidopsis thaliana GN=PME40 PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 6.457e-47
Identity = 114/275 (41.45%), Postives = 160/275 (58.18%), Query Frame = 1
Query:   79 VTENI*KKMDYLSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAA---SGNRFVIYVKAGVYKEKIRT--NKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRPEGSYHAI-TANGKTDPGQNTASLFRTVKLLRAPTML 879
            V E++ + +  +S   S+ LA++  I             ++ E+ G FP WVS  +R LLQ P      N++VAQ+GTGNY T+ EAISAA   S  RFVIY+K G Y E I     K  I  IGDG   T+I  + +   G +   +AT  + G GFIA+D+ F N AGP+  QA+AL  +SD + +YRCS   YQDT+Y  + +QFYR+ DIYGT+DFIFG+A+  FQNC L  RRP  +   I TA G+ +  + T     + ++L AP ++
Sbjct:  146 VAESLKESLFNISSHVSDSLAMLENIP-------GHIPGKVKEDVG-FPMWVSGSDRNLLQDPVDETKVNLVVAQNGTGNYTTIGEAISAAPNSSETRFVIYIKCGEYFENIEIPREKTMIMFIGDGIGRTVIKANRSYADGWTAFHSATVGVRGSGFIAKDLSFVNYAGPEKHQAVALRSSSDLSAYYRCSFESYQDTIYVHSHKQFYRECDIYGTVDFIFGDASVVFQNCSLYARRPNPNQKIIYTAQGRENSREPTGISIISSRILAAPDLI 412          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME_MEDSA (Pectinesterase/pectinesterase inhibitor OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 8.433e-47
Identity = 108/273 (39.56%), Postives = 156/273 (57.14%), Query Frame = 1
Query:   85 ENI*KKMDYLSQLTSNPLAL---VNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAPRINANVIVAQDGTGNYRTVSEAISAASGNR---FVIYVKAGVYKEKIRTNKDG--ITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNTASLFRTVKLLRAPTM 876
            E + K +    +L+SN + +   V+RI +       + +RRL  + G  P+WV+  +R+LL    +  N +VAQDG+G ++T+++A+          FVI+VKAGVYKE +   K+   +T+IGDG   T  TG  N   G +   TATF + G  F+A+DIGF NTAG    QA+AL V +D  +FY C + G+QDTLY  + RQFYRD  I GTIDF+FG     FQNC LV R P +G    +TA G+      +A +F++      P +
Sbjct:   64 ETMTKVLKTSMELSSNAIDMMDAVSRILKGFDTSQYSVSRRLLSDDG-IPSWVNDGHRRLLAGGNVQPNAVVAQDGSGQFKTLTDALKTVPPKNAVPFVIHVKAGVYKETVNVAKEMNYVTVIGDGPTKTKFTGSLNYADGINTYNTATFGVNGANFMAKDIGFENTAGTGKHQAVALRVTADQAIFYNCQMDGFQDTLYVQSQRQFYRDCSISGTIDFVFGERFGVFQNCKLVCRLPAKGQQCLVTAGGREKQNSASALVFQSSHFTGEPAL 335          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME32_ARATH (Probable pectinesterase/pectinesterase inhibitor 32 OS=Arabidopsis thaliana GN=PME32 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 8.433e-47
Identity = 102/211 (48.34%), Postives = 143/211 (67.77%), Query Frame = 1
Query:  220 FPNWVSAKNRKLLQAPRIN-ANVIVAQDGTGNYRTVSEAISAA---SGNRFVIYVKAGVYKE--KIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNT 831
            FP+WV   +RKLLQ   I  A+ +VA DGTGN+ T+S+A+ AA   S  R+VI+VK GVY E  +I+  K  I ++GDG   T+ITG+ +   G +   +ATF ++G GFIARDI F NTAGP+  QA+A+   +D  VFYRC++ GYQDTLYA ++RQF+R+  I GT+DFIFG+A A FQ+C +  ++      ++ITA G+ DP + T
Sbjct:  193 FPSWVKPGDRKLLQTDNITVADAVVAADGTGNFTTISDAVLAAPDYSTKRYVIHVKRGVYVENVEIKKKKWNIMMVGDGIDATVITGNRSFIDGWTTFRSATFAVSGRGFIARDITFQNTAGPEKHQAVAIRSDTDLGVFYRCAMRGYQDTLYAHSMRQFFRECIITGTVDFIFGDATAVFQSCQIKAKQGLPNQKNSITAQGRKDPNEPT 403          
The following BLAST results are available for this feature:
BLAST of EY660295 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
PME6_ARATH2.621e-4845.00Probable pectinesterase/pectinesterase inhibitor 6... [more]
PME45_ARATH3.333e-4840.37Putative pectinesterase/pectinesterase inhibitor 4... [more]
PME46_ARATH1.699e-4743.03Probable pectinesterase/pectinesterase inhibitor 4... [more]
PME12_ARATH1.699e-4743.85Probable pectinesterase/pectinesterase inhibitor 1... [more]
PME13_ARATH2.219e-4740.78Probable pectinesterase/pectinesterase inhibitor 1... [more]
PME24_ARATH2.898e-4743.60Putative pectinesterase/pectinesterase inhibitor 2... [more]
PME39_ARATH3.785e-4741.52Probable pectinesterase/pectinesterase inhibitor 3... [more]
PME40_ARATH6.457e-4741.45Probable pectinesterase/pectinesterase inhibitor 4... [more]
PME_MEDSA8.433e-4739.56Pectinesterase/pectinesterase inhibitor OS=Medicag... [more]
PME32_ARATH8.433e-4748.34Probable pectinesterase/pectinesterase inhibitor 3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-020-F08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY660295 ID=EY660295; Name=EY660295; organism=Citrus sinensis; type=EST; length=897bp
TTCAAACAAGGACGTGTCCGCTTTCCATTTCCCTAAAAAGACTTTGTGAA
TAGCCTCGGTCTCTCAGAGAGAAATGAGGTTACTGAAAACATATAAAAAA
AAATGGATTATTTGTCTCAACTGACCAGTAATCCTTTAGCCCTTGTCAAC
AGGATAGCCAGGGCTAGTTACCCAAAGAACAGCACATATAATCGGCGTCT
AGATGAGGAACAAGGTGATTTTCCCAACTGGGTATCGGCGAAAAATAGGA
AACTGCTGCAGGCCCCGCGCATAAATGCAAATGTGATTGTGGCTCAAGAT
GGAACTGGCAATTATAGAACTGTTTCGGAAGCTATCAGTGCTGCTTCTGG
AAATCGTTTTGTGATTTATGTGAAGGCAGGTGTTTATAAGGAGAAAATTC
GAACTAACAAGGACGGTATTACTTTGATAGGAGATGGCAAATACACTACT
ATTATTACTGGTGATGATAATGCTCGTAGAGGCACTTCCATGCCTGCAAC
CGCCACTTTCACAATCACAGGTGATGGATTTATCGCACGAGATATCGGAT
TTCATAACACAGCAGGACCCCAAGGAGAGCAAGCATTAGCTCTAAACGTA
GCCTCAGATCATACGGTCTTTTACAGGTGCAGCATTGCAGGCTACCAAGA
CACACTGTACGCCCTCGCTCTGCGTCAGTTCTACAGAGACACCGACATCT
ACGGGACCATCGACTTCATATTCGGAAACGCAGCCGCCCGTTTCCAGAAC
TGTTACCTGGTCCTTCGCCGCCCCGAAGGGAGCTACCATGCTATTACTGC
AAACGGGAAGACAGACCCTGGACAAAACACGGCTTCTCTTTTCAGAACTG
TAAAATTGCTGCGGGCTCCGACTATGCTCCAGTGAAAATAAATATAA
back to top