EY659796

Overview
NameEY659796
Unique NameEY659796
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_PHOLL (Xaa-Pro dipeptidase OS=Photorhabdus luminescens subsp. laumondii GN=pepQ PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 9.972e-17
Identity = 47/105 (44.76%), Postives = 65/105 (61.90%), Query Frame = 1
Query:   91 PHGLGHFLGIDTHDPGGYPK---GTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALLVPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            PHG+GH LG+  HD  G+ +   GT  +       LR  R L+ RMV+T+EPG YFI++LL P  E+E  SK F+   IG  K FGG+RIE ++++  N  +NMT
Sbjct:  335 PHGIGHPLGLQVHDVAGFMQDDTGTHLAAPDMYPYLRCTRILEPRMVLTIEPGLYFIESLLAPWRESE-FSKHFDWNKIGTLKLFGGIRIEDNIVIHENKVENMT 438          
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_EDWI9 (Xaa-Pro dipeptidase OS=Edwardsiella ictaluri (strain 93-146) GN=pepQ PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.302e-16
Identity = 50/124 (40.32%), Postives = 71/124 (57.26%), Query Frame = 1
Query:   37 MVGNVDEMMAARLGAVP-MPHGLGHFLGIDTHDPGGYPK---GTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALLVPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            + G  DE   A+    P +PHGLGH LG+  HD  G+ +   GT+ +       LR  R ++  MV+T+EPG YFID LL P +E E   + FN   I   + +GG+RIE +V+  A+G +NMT
Sbjct:  315 LTGISDEAAVAQGLTTPFLPHGLGHPLGLQVHDVAGFMQDELGTQMAAPDRYPYLRCTRIMEPGMVMTIEPGLYFIDTLLAPWLEGE-FGQHFNRGRIDALRPYGGIRIEDNVIFHAHGVENMT 437          
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_PSEHT (Xaa-Pro dipeptidase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pepQ PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.701e-16
Identity = 42/118 (35.59%), Postives = 71/118 (60.17%), Query Frame = 1
Query:   52 DEMMAARLGAVPMPHGLGHFLGIDTHDPGGY---PKGTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALLVPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            +E++  ++ +   PHGLGH LG+  HD GG+     G +++   G   LR  R +++  V T+EPG YFID+LL    + ++  +F N + +  FK +GG+RIE +++V  +  +NMT
Sbjct:  318 EEIVERKITSTFFPHGLGHHLGLQVHDMGGFMADEMGAQQAAPEGHPFLRCTRIIEKNQVFTIEPGLYFIDSLLGDLAQTDN-KQFINWQKVESFKPYGGIRIEDNIIVHEDSLENMT 434          
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_PSEHA (Xaa-Pro dipeptidase OS=Pseudoalteromonas haloplanktis GN=pepQ PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.701e-16
Identity = 44/117 (37.61%), Postives = 69/117 (58.97%), Query Frame = 1
Query:   55 EMMAARLGAVPMPHGLGHFLGIDTHDPGGYPK---GTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALLVPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            E++  ++ +   PHGLGH LG   HD GG+ +   G  ++   G   LR  R +++  V T+EPG YFID+LL    + ++  +F N E +  FK FGG+RIE +++V  +  +NMT
Sbjct:  319 EIVERQITSTFFPHGLGHHLGAQVHDVGGFMRDETGAHQAPPEGHPFLRCTRLIEKNQVFTIEPGLYFIDSLLGDLAQTDN-KQFINWEKVEAFKPFGGIRIEDNIIVHEDSLENMT 434          
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_SHIBS (Xaa-Pro dipeptidase OS=Shigella boydii serotype 4 (strain Sb227) GN=pepQ PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.222e-16
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 1
Query:   88 MPHGLGHFLGIDTHDPGGYPK---GTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALLVPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            MPHG+GH LG+  HD  G+ +   GT  +       LR  R LQ  MV+T+EPG YFI++LL P  E +  SK FN + I   K F G+RIE +V++  N  +NMT
Sbjct:  333 MPHGIGHPLGLQVHDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQ-FSKHFNWQKIEALKPFSGIRIEDNVVIHENNVENMT 437          
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_SHIB3 (Xaa-Pro dipeptidase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pepQ PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.222e-16
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 1
Query:   88 MPHGLGHFLGIDTHDPGGYPK---GTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALLVPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            MPHG+GH LG+  HD  G+ +   GT  +       LR  R LQ  MV+T+EPG YFI++LL P  E +  SK FN + I   K F G+RIE +V++  N  +NMT
Sbjct:  333 MPHGIGHPLGLQVHDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQ-FSKHFNWQKIEALKPFSGIRIEDNVVIHENNVENMT 437          
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_SHIDS (Xaa-Pro dipeptidase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pepQ PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.901e-16
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 1
Query:   88 MPHGLGHFLGIDTHDPGGYPK---GTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALLVPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            MPHG+GH LG+  HD  G+ +   GT  +       LR  R L   MV+T+EPG YFI++LL P  E +  SK FN + I   K FGG+RIE +V++  N  +NMT
Sbjct:  333 MPHGIGHPLGLQVHDVAGFMQDDSGTHLAAPAKYPYLRCTRILLPGMVLTIEPGIYFIESLLAPWREGQ-FSKHFNWQKIEALKPFGGIRIEDNVVIHENNVENMT 437          
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_ALTSX (Xaa-Pro dipeptidase OS=Alteromonas sp. GN=pepQ PE=1 SV=3)

HSP 1 Score: 85.1149 bits (209), Expect = 4.949e-16
Identity = 44/122 (36.07%), Postives = 71/122 (58.20%), Query Frame = 1
Query:   46 NVDEMMAARLGAVPMPHGLGHFLGIDTHDPGGY---PKGTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALL--VPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            + DE++A  + +   PHGLGH +G+  HD GG+    +G  +    G   LR  R+++   V T+EPG YFID+LL  + A +N   ++  N + +   K FGG+RIE +++V  +  +NMT
Sbjct:  316 SADEIVAKGITSTFFPHGLGHHIGLQVHDVGGFMADEQGAHQEPPEGHPFLRCTRKIEANQVFTIEPGLYFIDSLLGDLAATDN---NQHINWDKVAELKPFGGIRIEDNIIVHEDSLENMT 434          
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_SHEPA (Xaa-Pro dipeptidase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pepQ PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.464e-16
Identity = 47/121 (38.84%), Postives = 67/121 (55.37%), Query Frame = 1
Query:   43 GNVDEMMAARLGAVPMPHGLGHFLGIDTHDPGGY---PKGTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALLVPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            G+V  ++   +  V  PHGLGH LGI  HD GG+    KGT  +       LR  REL    V+T+EPG Y ID+LL    +++  S+  N   +   + FGG+RIE +V+V  +  +NMT
Sbjct:  314 GDVQGLVEQGITRVFFPHGLGHMLGIQVHDMGGFLSDEKGTHVAAPEAHPFLRCTRELDINQVLTIEPGVYIIDSLLAELKQDQRQSQ-INWNTVDVLRPFGGIRIEDNVIVHGDRIENMT 433          
BLAST of EY659796 vs. ExPASy Swiss-Prot
Match: PEPQ_ERWT9 (Xaa-Pro dipeptidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pepQ PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.464e-16
Identity = 46/118 (38.98%), Postives = 67/118 (56.78%), Query Frame = 1
Query:   52 DEMMAARLGAVPMPHGLGHFLGIDTHDPGGY---PKGTERSKEPGLKSLRTVRELQERMVITVEPGCYFIDALLVPAMENESTSKFFNHEVIGRFKDFGGVRIESDVLVTANGSKNMT 396
            + M+   L    MPHG+GH LG+  HD  G+    +GT  +       LR  R L+  MV+T+EPG YFID+LL P    +  S++F+   I   K +GG+RIE +V++  N  +NMT
Sbjct:  321 EAMVKENLTGPFMPHGIGHSLGLQVHDVAGFMQDDRGTHLAAPQQYPYLRCTRVLEPGMVLTIEPGIYFIDSLLAPWRAGK-FSQYFDWAKIDELKAYGGIRIEDNVVIHKNSVENMT 437          
The following BLAST results are available for this feature:
BLAST of EY659796 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 115
Match NameE-valueIdentityDescription
PEPQ_PHOLL9.972e-1744.76Xaa-Pro dipeptidase OS=Photorhabdus luminescens su... [more]
PEPQ_EDWI91.302e-1640.32Xaa-Pro dipeptidase OS=Edwardsiella ictaluri (stra... [more]
PEPQ_PSEHT1.701e-1635.59Xaa-Pro dipeptidase OS=Pseudoalteromonas haloplank... [more]
PEPQ_PSEHA1.701e-1637.61Xaa-Pro dipeptidase OS=Pseudoalteromonas haloplank... [more]
PEPQ_SHIBS2.222e-1644.34Xaa-Pro dipeptidase OS=Shigella boydii serotype 4 ... [more]
PEPQ_SHIB32.222e-1644.34Xaa-Pro dipeptidase OS=Shigella boydii serotype 18... [more]
PEPQ_SHIDS2.901e-1644.34Xaa-Pro dipeptidase OS=Shigella dysenteriae seroty... [more]
PEPQ_ALTSX4.949e-1636.07Xaa-Pro dipeptidase OS=Alteromonas sp. GN=pepQ PE=... [more]
PEPQ_SHEPA6.464e-1638.84Xaa-Pro dipeptidase OS=Shewanella pealeana (strain... [more]
PEPQ_ERWT96.464e-1638.98Xaa-Pro dipeptidase OS=Erwinia tasmaniensis (strai... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-015-B09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659796 ID=EY659796; Name=EY659796; organism=Citrus sinensis; type=EST; length=804bp
CAAAAAAGGCGGCGTCCGCGCTGAATTGCTAAAAAAATGGTTGGGAATGT
GGATGAGATGATGGCTGCACGATTGGGTGCTGTTCCCATGCCTCATGGTC
TTGGGCATTTCTTGGGTATTGACACTCATGATCCTGGCGGCTACCCAAAG
GGAACAGAAAGATCAAAAGAACCTGGCTTAAAATCTCTACGTACAGTTAG
AGAACTCCAGGAGAGAATGGTGATCACAGTGGAGCCTGGATGTTATTTCA
TTGATGCTCTGTTGGTCCCGGCCATGGAAAATGAAAGCACTTCCAAGTTT
TTTAATCATGAAGTAATTGGCAGATTCAAAGATTTTGGCGGTGTTCGCAT
TGAAAGTGATGTGCTTGTCACTGCCAATGGAAGCAAGAACATGACTAGCG
TACCTCGGGAAATATCAGATATTGAAGCCATAATGGCAGGCGCTCCATGG
CCTTCTAACAAGACTGCTCCATCAAATAGTTGAAAGTAGTGCCAAAGATC
TAAGAATAAGGCTCTGTTAGTGGAAGTTTTGGTCATAAACACCAAATTTC
TTGTTAGAATTATGAGCCAATTATTTTGAAACTGGAACTCTGAAACTAGA
ATTTTATCAAATGGCAAGTGCTTGTCGTTCTCACAATTGAATTTGAGTGG
TTAGCTTGGACAAAAGTTGTCTCTGTGTAAATGAATGGGGAAGAAAGTAA
TCCACTATGTTCTTTTCTTTAGAGATATGCATATGGTTTTCGTCACAGGA
CCAATAGATAATTTTTACTTCGGTTTGAAGATACATTTAAAAAAAAAAAA
AAAA
back to top