EY659701
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL1L_ARATH (RING-H2 finger protein ATL1L OS=Arabidopsis thaliana GN=ATL1L PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.300e-11 Identity = 28/58 (48.28%), Postives = 35/58 (60.34%), Query Frame = 3 Query: 45 LKYMKEAHVKDVGTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218 + Y E ++ + TEC +CLS F E V+ L C H FH CID WL SHS+CP CR Sbjct: 116 VSYSTELNLPGLDTECAICLSEFVAEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCR 173
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL5C_ARATH (RING-H2 finger protein ATL5C OS=Arabidopsis thaliana GN=ATL5C PE=2 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 4.309e-11 Identity = 26/46 (56.52%), Postives = 32/46 (69.57%), Query Frame = 3 Query: 81 GTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218 G EC VCL+ F EV+R L CKH+FH C+D WL +HS CP+CR Sbjct: 143 GLECAVCLARFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCR 188
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL4G_ARATH (RING-H2 finger protein ATL4G OS=Arabidopsis thaliana GN=ATL4G PE=2 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 4.309e-11 Identity = 27/44 (61.36%), Postives = 31/44 (70.45%), Query Frame = 3 Query: 87 ECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218 EC VCLS F D E R + CKH+FH CIDMW SHS+CP+CR Sbjct: 75 ECSVCLSEFKDNESGRVMPNCKHTFHVHCIDMWFHSHSSCPLCR 118
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL4L_ARATH (RING-H2 finger protein ATL4L OS=Arabidopsis thaliana GN=ATL4L PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.351e-11 Identity = 25/48 (52.08%), Postives = 34/48 (70.83%), Query Frame = 3 Query: 75 DVGTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218 D TEC +C++ F++GE +R L C H+FH +CID WL S S+CP CR Sbjct: 108 DSSTECAICITEFSEGEEIRILPLCSHAFHVACIDKWLTSRSSCPSCR 155
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL2G_ARATH (RING-H2 finger protein ATL2G OS=Arabidopsis thaliana GN=ATL2G PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.351e-11 Identity = 26/55 (47.27%), Postives = 33/55 (60.00%), Query Frame = 3 Query: 54 MKEAHVKDVGTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218 +K + G EC VCL F D E +R + C H FHA C+D+WL HS CP+CR Sbjct: 123 VKAVRIGKGGVECAVCLCEFEDDETLRLMPPCCHVFHADCVDVWLSEHSTCPLCR 177
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL1E_ARATH (RING-H2 finger protein ATL1E OS=Arabidopsis thaliana GN=ATL1E PE=2 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 7.351e-11 Identity = 26/46 (56.52%), Postives = 31/46 (67.39%), Query Frame = 3 Query: 81 GTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218 G CP+CLS +A E VR + C H FH CID WLK HS+CP+CR Sbjct: 250 GIICPICLSEYASKETVRCMPECDHCFHVQCIDEWLKIHSSCPVCR 295 The following BLAST results are available for this feature:
BLAST of EY659701 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 26
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY659701 ID=EY659701; Name=EY659701; organism=Citrus sinensis; type=EST; length=650bpback to top |