EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_HUMAN (Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_HORSE (Actin, cytoplasmic 1 OS=Equus caballus GN=ACTB PE=2 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_CHICK (Actin, cytoplasmic 1 OS=Gallus gallus GN=ACTB PE=1 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_CERAE (Actin, cytoplasmic 1 OS=Cercopithecus aethiops GN=ACTB PE=2 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_CAVPO (Actin, cytoplasmic 1 OS=Cavia porcellus GN=ACTB PE=2 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_CANFA (Actin, cytoplasmic 1 OS=Canis familiaris GN=ACTB PE=2 SV=3)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_CAMDR (Actin, cytoplasmic 1 OS=Camelus dromedarius GN=ACTB PE=1 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_BOVIN (Actin, cytoplasmic 1 OS=Bos taurus GN=ACTB PE=1 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT5_XENLA (Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT3_PODCA (Actin-3 OS=Podocoryne carnea GN=ACT3 PE=3 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 191/220 (86.82%), Postives = 209/220 (95.00%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAI+RLDLAGRDLTD +MKILTERGY FTTTAEREIVRD+KEKLAYVALD+EQE++TA +SSS+EK+YELPDGQ+ITIG ERFRCPE LFQP+ IGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGG+TMFPGIADRM KEI++LAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAIIRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMQTAVTSSSLEKSYELPDGQVITIGNERFRCPETLFQPAFIGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEISSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACTB_HUMAN6.855e-11087.27Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 ... [more]
ACTB_HORSE6.855e-11087.27Actin, cytoplasmic 1 OS=Equus caballus GN=ACTB PE=... [more]
ACTB_CHICK6.855e-11087.27Actin, cytoplasmic 1 OS=Gallus gallus GN=ACTB PE=1... [more]
ACTB_CERAE6.855e-11087.27Actin, cytoplasmic 1 OS=Cercopithecus aethiops GN=... [more]
ACTB_CAVPO6.855e-11087.27Actin, cytoplasmic 1 OS=Cavia porcellus GN=ACTB PE... [more]
ACTB_CANFA6.855e-11087.27Actin, cytoplasmic 1 OS=Canis familiaris GN=ACTB P... [more]
ACTB_CAMDR6.855e-11087.27Actin, cytoplasmic 1 OS=Camelus dromedarius GN=ACT... [more]
ACTB_BOVIN6.855e-11087.27Actin, cytoplasmic 1 OS=Bos taurus GN=ACTB PE=1 SV... [more]
ACT5_XENLA6.855e-11087.27Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 S... [more]
ACT3_PODCA6.855e-11086.82Actin-3 OS=Podocoryne carnea GN=ACT3 PE=3 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top