EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_CAEEL (Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=2 SV=3)

HSP 1 Score: 397.897 bits (1021), Expect = 4.019e-110
Identity = 191/220 (86.82%), Postives = 208/220 (94.55%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+IT+G ERFRCPE LFQPS +GME+AGIHET+YNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_ONCVO (Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 4.019e-110
Identity = 190/220 (86.36%), Postives = 209/220 (95.00%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+IT+G ERFRCPE LFQPS +GME+AGIHE+TYNSIMKCD+DIRKDLY NIVLSGG+TM+PGIADRM KE+TALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQ+WISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHESTYNSIMKCDIDIRKDLYANIVLSGGTTMYPGIADRMQKEVTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQVWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_HELTB (Actin CyI, cytoplasmic OS=Heliocidaris tuberculata PE=3 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 4.019e-110
Identity = 195/220 (88.64%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFR PE LFQPS +GME+AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTMFPGIADRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRAPESLFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_HELER (Actin CyI, cytoplasmic OS=Heliocidaris erythrogramma PE=3 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 4.019e-110
Identity = 195/220 (88.64%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFR PE LFQPS +GME+AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTMFPGIADRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRAPESLFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTC_BRALA (Actin, cytoplasmic OS=Branchiostoma lanceolatum PE=2 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 5.248e-110
Identity = 192/220 (87.27%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRD TD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ G+HETTYNSIMKCD+DIRKDLY N VLSGG+TMFPGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVSHTVPIYEGYALPHAILRLDLAGRDQTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESTGVHETTYNSIMKCDIDIRKDLYANTVLSGGTTMFPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_LYTPI (Actin, cytoskeletal 1 OS=Lytechinus pictus PE=2 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 5.248e-110
Identity = 193/220 (87.73%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVS+TVPIYEGYALPHAILRLDLAGRD+TD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE++TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+AGIHET YNSIMKCDVDIRKDLY N VLSGGSTMFPGIADRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSYTVPIYEGYALPHAILRLDLAGRDITDYLMKILTERGYTFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETCYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT_CHLRE (Actin OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 194/220 (88.18%), Postives = 208/220 (94.55%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKIL ERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSS++EK YELPDGQ+ITIG ERFRCPEVLF P++IGMEA GIH+TT+NSIMKCDVDIRKDLY NIVLSGG+TMFPGIADRMSKEITALAPS+MKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILMERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATALSSSALEKTYELPDGQMITIGNERFRCPEVLFNPNMIGMEAVGIHDTTFNSIMKCDVDIRKDLYNNIVLSGGTTMFPGIADRMSKEITALAPSAMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTG_XENTR (Actin, cytoplasmic 2 OS=Xenopus tropicalis GN=actg1 PE=2 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTG_XENLA (Actin, cytoplasmic 2 OS=Xenopus laevis GN=actg1 PE=2 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTG_TRIVU (Actin, cytoplasmic 2 OS=Trichosurus vulpecula GN=ACTG1 PE=1 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACT2_CAEEL4.019e-11086.82Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=2 SV... [more]
ACT1_ONCVO4.019e-11086.36Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1[more]
ACT1_HELTB4.019e-11088.64Actin CyI, cytoplasmic OS=Heliocidaris tuberculata... [more]
ACT1_HELER4.019e-11088.64Actin CyI, cytoplasmic OS=Heliocidaris erythrogram... [more]
ACTC_BRALA5.248e-11087.27Actin, cytoplasmic OS=Branchiostoma lanceolatum PE... [more]
ACT1_LYTPI5.248e-11087.73Actin, cytoskeletal 1 OS=Lytechinus pictus PE=2 SV... [more]
ACT_CHLRE6.855e-11088.18Actin OS=Chlamydomonas reinhardtii PE=2 SV=1[more]
ACTG_XENTR6.855e-11087.27Actin, cytoplasmic 2 OS=Xenopus tropicalis GN=actg... [more]
ACTG_XENLA6.855e-11087.27Actin, cytoplasmic 2 OS=Xenopus laevis GN=actg1 PE... [more]
ACTG_TRIVU6.855e-11087.27Actin, cytoplasmic 2 OS=Trichosurus vulpecula GN=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top