EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP11_HUMAN (Actin-related protein 11 OS=Homo sapiens GN=ARP11 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.736e-12
Identity = 45/148 (30.41%), Postives = 70/148 (47.30%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDG--------QIITIGAERFRCPEVLFQPSLIGMEA-AGIHETTYNSIMKCDVDIRKDLY 428
            GDGV+H +P+ EGY +   I  + +AGRD+T  + ++L ER          E  + +KEK  Y+  D  +E   AK     +K  +   G         +I +G ERF  PE+ F P     ++   I +     I  C +D+R+ LY
Sbjct:   42 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEF--AKYDVDPQKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLY 187          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP5_SCHPO (Actin-like protein arp5 OS=Schizosaccharomyces pombe GN=arp5 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.267e-12
Identity = 45/183 (24.59%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  108 ALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIV 656
            +L K L E    FT     + + D +  L Y       + +     + V + ++L       +  E+ R PEV+F PS++G++ AGI E   + + +  ++ ++ L  N++++GG    PG+  R+ +E+T++ P    I V          W G S  +    F+   +++ EY E GP  +
Sbjct:  539 SLEKQLLEYDSQFTQANTYDTLNDPRATLLYAFTRGVSDFDV----NDVAQAFQLH------LNVEQIRVPEVIFSPSIVGIDQAGILEIMRSILQRHSLEEQQKLVSNVLITGGLGSLPGMETRIKRELTSIMPVGSSINVFRASNPLLDAWKGASEWSVTEKFKAAKVTREEYLEKGPEYI 711          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP4_CANAL (Actin-related protein 4 OS=Candida albicans GN=ARP4 PE=3 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 5.051e-12
Identity = 37/97 (38.14%), Postives = 60/97 (61.86%), Query Frame = 3
Query:  363 GIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVA---PPERKYSVWIGGSILASLSTFQQMWISKGEYDESG 644
            GI +   +++   D+D+R  L  NI+++GG ++   + +R+  E++   P  +KI++ A     ER    WIGGS+LASL TF QMW++K EY+E G
Sbjct:  364 GISQLISHTLSNIDIDLRASLANNIIVTGGVSLISQLTERLYLELSNNNPG-LKIRLHAVGNSTERINQAWIGGSVLASLGTFHQMWVTKEEYNEVG 459          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP5_DROME (Actin-related protein 5 OS=Drosophila melanogaster GN=Arp5 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.616e-12
Identity = 41/132 (31.06%), Postives = 63/132 (47.73%), Query Frame = 3
Query:  249 SVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESG 644
            S  +NY+L        G E  R PEVLFQPS+IG   AG+ E     +       ++ L  ++ L+GG   F G+ +R+ KE+  + P   K  +    E   S W+G  + A   TF Q   ++ ++ E G
Sbjct:  504 SAAENYQLH------FGVENIRVPEVLFQPSMIGCSEAGLAELIAFVLKLFPAAEQQRLVEHVYLTGGCAQFKGLKERLIKELMEMRPFQSKFAIYESDEPTLSAWLGACVHAGEPTFGQTLTTRQDHQEHG 629          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP5_YEAST (Actin-related protein 5 OS=Saccharomyces cerevisiae GN=ARP5 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.507e-11
Identity = 41/131 (31.30%), Postives = 67/131 (51.15%), Query Frame = 3
Query:  294 IGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMK---------CDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA-SLSTFQQMWISKGEYDESGPSIV 656
            +  ER R PEV+FQP++ G + AGI E +   ++K             I  D+  N++++GG+   PG+ +R+ KE T   P+   I V    +     W G + LA +   +++  ISK EY+E GP  +
Sbjct:  614 LNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSI--DMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMSSDPSLDAWKGMAALARNEEQYRKTVISKKEYEEYGPEYI 742          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP10_BOVIN (Actin-related protein 10 OS=Bos taurus GN=ACTR10 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.294e-11
Identity = 65/241 (26.97%), Postives = 108/241 (44.81%), Query Frame = 3
Query:   24 SHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAERE------------IVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELP----------DGQII--TIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVA--------PPERKYSV-WIGGSILASL-STFQQMWISKGEYDESG 644
            S  +PIYEG  + +    L L G+ L   L   L E+  + T  A+ +            I+ D+K +  +V+ D ++ L    +  +++ N E P          DG+ I   +G+ R    E+LF+      E   +     +S+M+C +D RK L  N+V+ GG++M PG   R+  EI  L       K +A        PP +   V W+GG+I  +L        +SK  Y+++G
Sbjct:  146 SLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGILEDIKVRTCFVS-DLKRGLNIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQD---NEEKSVATLILDSLMQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLATKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKDYYNQTG 382          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ARP11_HUMAN1.736e-1230.41Actin-related protein 11 OS=Homo sapiens GN=ARP11 ... [more]
ARP5_SCHPO2.267e-1224.59Actin-like protein arp5 OS=Schizosaccharomyces pom... [more]
ARP4_CANAL5.051e-1238.14Actin-related protein 4 OS=Candida albicans GN=ARP... [more]
ARP5_DROME8.616e-1231.06Actin-related protein 5 OS=Drosophila melanogaster... [more]
ARP5_YEAST2.507e-1131.30Actin-related protein 5 OS=Saccharomyces cerevisia... [more]
ARP10_BOVIN7.294e-1126.97Actin-related protein 10 OS=Bos taurus GN=ACTR10 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top