EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: BRI1_SOLPE (Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.446e-25
Identity = 74/249 (29.72%), Postives = 118/249 (47.39%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNN--------------------YXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMS-LKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            FSG +P ++G   +LE + + NN                                   +N  KL  + ++ N L GI+PS I    M+ LK LY+ N    G IP S+                TG IP++ G L KL+ L L  N+L G  P EL +L  L+ L+L  N L+G IP+ LSN T L  + L +N+ +  IP++   L ++      +N + G + +++GN + L+ ++L+ N L+G +P
Sbjct:  340 FSGMVPESLGECSSLELVDISNNNFSGKLPVDTLLKLSNIKTMVLSFNKFVGGLPDSFSNLPKLETLDMSSNNLTGIIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNGSIP 588          

HSP 2 Score: 112.079 bits (279), Expect = 4.650e-24
Identity = 73/256 (28.52%), Postives = 126/256 (49.22%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPT-TFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPS--CLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            ++ F G I +++ +   L +L L NN                  + L+ + L GN   G+ P+ + +L  ++  L +   + SG +P+S+G               +G +P  T  +L  ++ + L+FNK VG  PD   +L +L+ L +  N L+G IPS  C   + +L+ LYL +N F   IP +  +   ++  D S N+L G + S +G+L  L  + L  N LSG++P  +  L+ L+ + L +N L GP
Sbjct:  266 SNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVPKLPS-------ESLQYLYLRGNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISNNNFSGKLPVDTLLKLSNIKTMVLSFNKFVGGLPDSFSNLPKLETLDMSSNNLTGIIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGP 514          

HSP 3 Score: 92.0485 bits (227), Expect = 4.980e-18
Identity = 89/338 (26.33%), Postives = 127/338 (37.57%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNN---------------------YXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLS------------------------GSIPSCLSN---------LTSLRSLYL---GSNR--------------------------------FTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            F G +P++  NL  LE L + +N                     Y              +NC +L  + L+ N L G +PSS+G+LS  LK L +    +SG IPQ +                TGPIP +     KL  + L+ N+L G  P  L  L  L  L L  N +S                        GSIP  L           LT  R +Y+   GS                                  +  +   TF     ++F D S N L G +  ++G +  L  +NL  N+LSG +P  +GGLK++ I+DL+YNR  G
Sbjct:  389 FVGGLPDSFSNLPKLETLDMSSNNLTGIIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLS-KLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNLLEFGGIRQEQLDRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNG 725          

HSP 4 Score: 73.1738 bits (178), Expect = 2.394e-12
Identity = 71/219 (32.42%), Postives = 95/219 (43.38%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSI----GNLSMSLKT----LYIGN-----CSISGNIPQSIGXXXXXXXXXXXXXXXT------GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVG 616
            SG IP ++G L NL  L LGNN                NC+ L  + L  N LNG +P  +    GN++++L T    +YI N     C  +GN+ +  G                      G    TF     +  L L++NKL GS P EL  +  L  L L  N LSG IP  L  L ++  L L  NRF   IP++  SL  +   D S+N L G
Sbjct:  536 SGEIPASLGRLSNLAILKLGNN-----SISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNLLEFGGIRQEQLDRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSG 749          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PEPR2_ARATH (Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.888e-25
Identity = 74/251 (29.48%), Postives = 123/251 (49.00%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++FSG +P+T+GN  +LE+L L NN                + + L  + L  N L+G++P+S+G L + L  L +   ++SG IP+ +G                G +P +   L+ L  L+++ N L G       +  +L  L L  N   G +P  + N +SL SL +     T  IPS+   L+ +   D S N L G +  ++GN   L  + L++N L G++P  +  LK LQ ++L +N+L G
Sbjct:  110 NSFSGLLPSTLGNCTSLEYLDLSNN-----DFSGEVPDIFGSLQNLTFLYLDRNNLSGLIPASVGGL-IELVDLRMSYNNLSGTIPELLGNCSKLEYLALNNNKLNGSLPASLYLLENLGELFVSNNSLGGRLHFGSSNCKKLVSLDLSFNDFQGGVPPEIGNCSSLHSLVMVKCNLTGTIPSSMGMLRKVSVIDLSDNRLSGNIPQELGNCSSLETLKLNDNQLQGEIPPALSKLKKLQSLELFFNKLSG 354          

HSP 2 Score: 112.849 bits (281), Expect = 2.726e-24
Identity = 82/251 (32.67%), Postives = 119/251 (47.41%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVL-LGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            F+G IP  + + + L    LG+N                 CK L  + L  N L+G+LP    +LS+S   L  G+ S  G+IP+S+G               TG IP   G LQ L  L L+ N L G  P +L    RL    +  N L+GSIPS   +  SL +L L  N F   IP     L  +     + N   G + S +G LK L  G++LS N  +G++P T+G L +L+ ++++ N+L GP
Sbjct:  424 FTGEIPPHLCHGQKLRLFILGSNQLHGKIPASIR-----QCKTLERVRLEDNKLSGVLPEFPESLSLSYVNL--GSNSFEGSIPRSLGSCKNLLTIDLSQNKLTGLIPPELGNLQSLGLLNLSHNYLEGPLPSQLSGCARLLYFDVGSNSLNGSIPSSFRSWKSLSTLVLSDNNFLGAIPQFLAELDRLSDLRIARNAFGGKIPSSVGLLKSLRYGLDLSANVFTGEIPTTLGALINLERLNISNNKLTGP 667          

HSP 3 Score: 111.694 bits (278), Expect = 6.074e-24
Identity = 81/267 (30.34%), Postives = 119/267 (44.57%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNN-------------------YXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP  +GN   LE+L L NN                   +              +NCKKL  + L+ N   G +P  IGN S SL +L +  C+++G IP S+G                         L+K+  + L+ N+L G+ P EL +   L+ L L  N+L G IP  LS L  L+SL L  N+ +  IP   W ++ +      +N L G L  ++  LK L  + L  N   GD+P ++G  + L+ +DL  NR  G
Sbjct:  185 SGTIPELLGNCSKLEYLALNNNKLNGSLPASLYLLENLGELFVSNNSLGGRLHFGSSNCKKLVSLDLSFNDFQGGVPPEIGNCS-SLHSLVMVKCNLTGTIPSSMGM------------------------LRKVSVIDLSDNRLSGNIPQELGNCSSLETLKLNDNQLQGEIPPALSKLKKLQSLELFFNKLSGEIPIGIWKIQSLTQMLVYNNTLTGELPVEVTQLKHLKKLTLFNNGFYGDIPMSLGLNRSLEEVDLLGNRFTG 426          

HSP 4 Score: 105.916 bits (263), Expect = 3.333e-22
Identity = 65/208 (31.25%), Postives = 112/208 (53.85%), Query Frame = 2
Query:  137 KKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            K L  + L+ N  +G+LPS++GN + SL+ L + N   SG +P   G               +G IP + G L +L  L +++N L G+ P+ L +  +L+ L L  NKL+GS+P+ L  L +L  L++ +N     +     + K ++  D S N   G +  +IGN   L  + + + NL+G +P+++G L+ + ++DL+ NRL G
Sbjct:  100 KSLVTLDLSLNSFSGLLPSTLGNCT-SLEYLDLSNNDFSGEVPDIFGSLQNLTFLYLDRNNLSGLIPASVGGLIELVDLRMSYNNLSGTIPELLGNCSKLEYLALNNNKLNGSLPASLYLLENLGELFVSNNSLGGRLHFGSSNCKKLVSLDLSFNDFQGGVPPEIGNCSSLHSLVMVKCNLTGTIPSSMGMLRKVSVIDLSDNRLSG 306          

HSP 5 Score: 95.9005 bits (237), Expect = 3.449e-19
Identity = 72/231 (31.17%), Postives = 111/231 (48.05%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLR-SLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            SG +P    +L +L ++ LG+N                +CK L  I L+ N L G++P  +GNL  SL  L + +  + G +P  +                 G IP++F   + L  L L+ N  +G+ P  L  L RL  L +  N   G IPS +  L SLR  L L +N FT  IP+T  +L ++   + S+N L GPLS  + +LK L  +++S N  +G +P  +
Sbjct:  473 SGVLPEFPESL-SLSYVNLGSN-----SFEGSIPRSLGSCKNLLTIDLSQNKLTGLIPPELGNLQ-SLGLLNLSHNYLEGPLPSQLSGCARLLYFDVGSNSLNGSIPSSFRSWKSLSTLVLSDNNFLGAIPQFLAELDRLSDLRIARNAFGGKIPSSVGLLKSLRYGLDLSANVFTGEIPTTLGALINLERLNISNNKLTGPLSV-LQSLKSLNQVDVSYNQFTGPIPVNL 695          

HSP 6 Score: 77.7962 bits (190), Expect = 9.719e-14
Identity = 47/133 (35.34%), Postives = 70/133 (52.63%), Query Frame = 2
Query:  362 LQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ L L+ + L G    E+  L  L  L L  N  SG +PS L N TSL  L L +N F+  +P  F SL+++ F     N L G + + +G L  L+ + +S NNLSG +P  +G    L+ + L  N+L G
Sbjct:   78 VETLNLSASGLSGQLGSEIGELKSLVTLDLSLNSFSGLLPSTLGNCTSLEYLDLSNNDFSGEVPDIFGSLQNLTFLYLDRNNLSGLIPASVGGLIELVDLRMSYNNLSGTIPELLGNCSKLEYLALNNNKLNG 210          

HSP 7 Score: 72.7886 bits (177), Expect = 3.127e-12
Identity = 48/173 (27.75%), Postives = 83/173 (47.98%), Query Frame = 2
Query:  242 CSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            C +SGN+ +++                +G + +  G L+ L  L L+ N   G  P  L +   L+ L L  N  SG +P    +L +L  LYL  N  + +IP++   L +++    S N L G +   +GN   L  + L+ N L+G +PA++  L++L  + ++ N L G
Sbjct:   71 CDLSGNVVETLNLSASGL---------SGQLGSEIGELKSLVTLDLSLNSFSGLLPSTLGNCTSLEYLDLSNNDFSGEVPDIFGSLQNLTFLYLDRNNLSGLIPASVGGLIELVDLRMSYNNLSGTIPELLGNCSKLEYLALNNNKLNGSLPASLYLLENLGELFVSNNSLGG 234          

HSP 8 Score: 70.0922 bits (170), Expect = 2.027e-11
Identity = 52/194 (26.80%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  179 GILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G++    GN+   ++TL +    +SG +   IG               +G +P+T G    L+ L L+ N   G  PD    L  L  L L  N LSG IP+ +  L  L  L +  N  +  IP    +   + +   ++N L G L + +  L+ L  + +S N+L G +       K L  +DL++N  +G
Sbjct:   68 GVICDLSGNV---VETLNLSASGLSGQLGSEIGELKSLVTLDLSLNSFSGLLPSTLGNCTSLEYLDLSNNDFSGEVPDIFGSLQNLTFLYLDRNNLSGLIPASVGGLIELVDLRMSYNNLSGTIPELLGNCSKLEYLALNNNKLNGSLPASLYLLENLGELFVSNNSLGGRLHFGSSNCKKLVSLDLSFNDFQG 258          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.221e-25
Identity = 73/230 (31.74%), Postives = 118/230 (51.30%), Query Frame = 2
Query:   14 FSGFIP-NTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMS-LKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            FSG +P +T+  L N++ + L  N               +N  KL  + ++ N L G++PS I    M+ LK LY+ N    G IP S+                TG IP++ G L KL+ L L  N+L G  P EL +L  L+ L+L  N L+G IP+ LSN T L  + L +N+ +  IP++   L ++      +N + G + +++GN + L+ ++L+ N L+G +P
Sbjct:  364 FSGKLPVDTLSKLSNIKTMVLSFN-----KFVGGLPDSFSNLLKLETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNGSIP 588          

HSP 2 Score: 112.849 bits (281), Expect = 2.726e-24
Identity = 73/256 (28.52%), Postives = 126/256 (49.22%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPT-TFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPS--CLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            ++ F G I +++ +   L +L L NN                  + L+ + L GN   G+ P+ + +L  ++  L +   + SG +P+S+G               +G +P  T  +L  ++ + L+FNK VG  PD   +L +L+ L +  N L+G IPS  C   + +L+ LYL +N F   IP +  +   ++  D S N+L G + S +G+L  L  + L  N LSG++P  +  L+ L+ + L +N L GP
Sbjct:  266 SNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVPKLPS-------ESLQYLYLRGNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPDSFSNLLKLETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGP 514          

HSP 3 Score: 108.612 bits (270), Expect = 5.142e-23
Identity = 76/251 (30.28%), Postives = 120/251 (47.81%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSI--GXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG +P ++G   +LE + +  N               +    ++ + L+ N   G LP S  NL + L+TL + + +++G IP  I                   GPIP +     +L  L L+FN L GS P  L  L +L  L+L+ N+LSG IP  L  L +L +L L  N  T  IP++  +   + +   S+N L G + + +G L  L  + L  N++SG++PA +G  + L  +DL  N L G
Sbjct:  340 FSGMVPESLGECSSLELVDISYN----NFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPDSFSNL-LKLETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNG 585          

HSP 4 Score: 92.0485 bits (227), Expect = 4.980e-18
Identity = 89/338 (26.33%), Postives = 127/338 (37.57%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNN---------------------YXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLS------------------------GSIPSCLSN---------LTSLRSLYL---GSNR--------------------------------FTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            F G +P++  NL  LE L + +N                     Y              +NC +L  + L+ N L G +PSS+G+LS  LK L +    +SG IPQ +                TGPIP +     KL  + L+ N+L G  P  L  L  L  L L  N +S                        GSIP  L           LT  R +Y+   GS                                  +  +   TF     ++F D S N L G +  ++G +  L  +NL  N+LSG +P  +GGLK++ I+DL+YNR  G
Sbjct:  389 FVGGLPDSFSNLLKLETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLS-KLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNLLEFGGIRQEQLDRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNG 725          

HSP 5 Score: 73.1738 bits (178), Expect = 2.394e-12
Identity = 71/219 (32.42%), Postives = 95/219 (43.38%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSI----GNLSMSLKT----LYIGN-----CSISGNIPQSIGXXXXXXXXXXXXXXXT------GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVG 616
            SG IP ++G L NL  L LGNN                NC+ L  + L  N LNG +P  +    GN++++L T    +YI N     C  +GN+ +  G                      G    TF     +  L L++NKL GS P EL  +  L  L L  N LSG IP  L  L ++  L L  NRF   IP++  SL  +   D S+N L G
Sbjct:  536 SGEIPASLGRLSNLAILKLGNN-----SISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNLLEFGGIRQEQLDRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSG 749          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y2579_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 9.370e-25
Identity = 81/248 (32.66%), Postives = 115/248 (46.37%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLE 757
            F+G I N IG   NL  L LG N                N  +L  + L  N L G +P  +G +  +LK +Y+G  ++SG IP  IG               +GPIP + G L+KL+ ++L  NKL G  P  +  L  L  L    N LSG IP  ++ + SL  L+L SN  T  IP    SL  +      SN   G + +++G    L  ++LS NNL+G +P T+     L  + L  N L+
Sbjct:  157 FTGEIYNDIGVFSNLRVLDLGGNVLTGHVPGYL-----GNLSRLEFLTLASNQLTGGVPVELGKMK-NLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLSGQIPPSIFSLQNLISLDFSDNSLSGEIPELVAQMQSLEILHLFSNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGIPANLGKHNNLTVLDLSTNNLTGKLPDTLCDSGHLTKLILFSNSLD 398          

HSP 2 Score: 108.997 bits (271), Expect = 3.937e-23
Identity = 79/249 (31.73%), Postives = 112/249 (44.98%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG IP   G L NL  L L NN                    LR + L GN L G +P  +GNLS  L+ L + +  ++G +P  +G               +G IP   G L  L  L L +N L G  P  L  L +L+ + L+ NKLSG IP  + +L +L SL    N  +  IP     ++ +      SN L G +   + +L  L  + L  N  SG +PA +G   +L ++DL+ N L G
Sbjct:  135 FSGSIPR--GFLPNLYTLDLSNNMFTGEIYNDIGVF-----SNLRVLDLGGNVLTGHVPGYLGNLSR-LEFLTLASNQLTGGVPVELGKMKNLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLSGQIPPSIFSLQNLISLDFSDNSLSGEIPELVAQMQSLEILHLFSNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGIPANLGKHNNLTVLDLSTNNLTG 375          

HSP 3 Score: 102.834 bits (255), Expect = 2.821e-21
Identity = 70/252 (27.78%), Postives = 113/252 (44.84%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++  +G +P  +G ++NL+W+ LG N                    L  + L  N L+G +P S+G+L   L+ +++    +SG IP SI                +G IP    ++Q L+ L+L  N L G  P+ +  L RL  L L+ N+ SG IP+ L    +L  L L +N  T  +P T      +      SN L   +   +G  + L  + L  N  SG +P     L+ +  +DL+ N L+G
Sbjct:  202 SNQLTGGVPVELGKMKNLKWIYLGYN-----NLSGEIPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLK-KLEYMFLYQNKLSGQIPPSIFSLQNLISLDFSDNSLSGEIPELVAQMQSLEILHLFSNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGIPANLGKHNNLTVLDLSTNNLTGKLPDTLCDSGHLTKLILFSNSLDSQIPPSLGMCQSLERVRLQNNGFSGKLPRGFTKLQLVNFLDLSNNNLQG 447          

HSP 4 Score: 96.6709 bits (239), Expect = 2.022e-19
Identity = 74/252 (29.37%), Postives = 112/252 (44.44%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ FSG IP  +G   NL  L L  N                +   L  + L  N L+  +P S+G +  SL+ + + N   SG +P+                   G I T    + +L+ L L+ NK  G  PD      RL KL L  NK+SG +P  L     +  L L  N  T VIP    S K+++  D S N   G + S     +VL  ++LS N LSG++P  +G ++ L  +++++N L G
Sbjct:  346 SNRFSGGIPANLGKHNNLTVLDLSTN-----NLTGKLPDTLCDSGHLTKLILFSNSLDSQIPPSLG-MCQSLERVRLQNNGFSGKLPRGFTKLQLVNFLDLSNNNLQGNINTW--DMPQLEMLDLSVNKFFGELPD-FSRSKRLKKLDLSRNKISGVVPQGLMTFPEIMDLDLSENEITGVIPRELSSCKNLVNLDLSHNNFTGEIPSSFAEFQVLSDLDLSCNQLSGEIPKNLGNIESLVQVNISHNLLHG 588          

HSP 5 Score: 96.2857 bits (238), Expect = 2.641e-19
Identity = 66/215 (30.70%), Postives = 102/215 (47.44%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            LR + L+ N  +G +P        +L TL + N   +G I   IG               TG +P   G L +L+ L LA N+L G  P EL  +  L  + L  N LSG IP  +  L+SL  L L  N  +  IP +   LK + +     N L G +   I +L+ L+ ++ S+N+LSG++P  +  ++ L+I+ L  N L G     + +L
Sbjct:  125 LRYLNLSNNNFSGSIPRGF---LPNLYTLDLSNNMFTGEIYNDIGVFSNLRVLDLGGNVLTGHVPGYLGNLSRLEFLTLASNQLTGGVPVELGKMKNLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLSGQIPPSIFSLQNLISLDFSDNSLSGEIPELVAQMQSLEILHLFSNNLTGKIPEGVTSL 336          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: IMK2_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 9.370e-25
Identity = 78/263 (29.66%), Postives = 122/263 (46.39%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTF-GRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            H +  +G +P ++G L++L  + L NN                NC  L+++ L+ N L G +P S+   S  L  L +   S+SG +P S+                +G IP  F      L+ L L  N+  G+ P  LC    L+++ +  N+LSGSIP     L  L+SL    N     IP +F +L  ++  +  SN L GP+   I  L  L  +NL  N ++G +P TIG +  ++ +DL+ N   GP    +V L
Sbjct:  126 HNNVIAGSVPRSLGYLKSLRGVYLFNN-----RLSGSIPVSLGNCPLLQNLDLSSNQLTGAIPPSLTE-STRLYRLNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSGSIPDFFVNGSHPLKTLNLDHNRFSGAVPVSLCKHSLLEEVSISHNQLSGSIPRECGGLPHLQSLDFSYNSINGTIPDSFSNLSSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNKINGPIPETIGNISGIKKLDLSENNFTGPIPLSLVHL 382          

HSP 2 Score: 91.6633 bits (226), Expect = 6.504e-18
Identity = 59/185 (31.89%), Postives = 83/185 (44.86%), Query Frame = 2
Query:  152 IGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            + L  N L+G +P    N S  LKTL + +   SG +P S+                +G IP   G L  LQ L  ++N + G+ PD   +L  L  L L  N L G IP  +  L +L  L L  N+    IP T  ++  I   D S N   GP+   + +L  L   N+S N LSG +P  +
Sbjct:  219 LDLQHNNLSGSIPDFFVNGSHPLKTLNLDHNRFSGAVPVSLCKHSLLEEVSISHNQLSGSIPRECGGLPHLQSLDFSYNSINGTIPDSFSNLSSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNKINGPIPETIGNISGIKKLDLSENNFTGPIPLSLVHLAKLSSFNVSYNTLSGPVPPVL 403          

HSP 3 Score: 82.4185 bits (202), Expect = 3.946e-15
Identity = 53/146 (36.30%), Postives = 74/146 (50.68%), Query Frame = 2
Query:  326 GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP-ATIGGLKDLQIMDLAYNRLEG 760
            G I    G+L  L+ L L  N + GS P  L +L  L  + LF N+LSGSIP  L N   L++L L SN+ T  IP +      +   + S N L GPL   +     L  ++L  NNLSG +P   + G   L+ ++L +NR  G
Sbjct:  108 GTISEKIGQLGSLRKLSLHNNVIAGSVPRSLGYLKSLRGVYLFNNRLSGSIPVSLGNCPLLQNLDLSSNQLTGAIPPSLTESTRLYRLNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSGSIPDFFVNGSHPLKTLNLDHNRFSG 253          

HSP 4 Score: 77.7962 bits (190), Expect = 9.719e-14
Identity = 57/196 (29.08%), Postives = 83/196 (42.35%), Query Frame = 2
Query:  248 ISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGN----LK---------------------VLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + G I + IG                G +P + G L+ L+G+YL  N+L GS P  L +   L  L L  N+L+G+IP  L+  T L  L L  N  +  +P +      + F D   N L G +     N    LK                     +L  +++S N LSG +P   GGL  LQ +D +YN + G
Sbjct:  106 LGGTISEKIGQLGSLRKLSLHNNVIAGSVPRSLGYLKSLRGVYLFNNRLSGSIPVSLGNCPLLQNLDLSSNQLTGAIPPSLTESTRLYRLNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSGSIPDFFVNGSHPLKTLNLDHNRFSGAVPVSLCKHSLLEEVSISHNQLSGSIPRECGGLPHLQSLDFSYNSING 301          

HSP 5 Score: 77.0258 bits (188), Expect = 1.658e-13
Identity = 45/130 (34.62%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  371 LYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + L +  L G+  +++  LG L KL L  N ++GS+P  L  L SLR +YL +NR +  IP +  +   +   D SSN L G +   +     L  +NLS N+LSG +P ++     L  +DL +N L G
Sbjct:   99 IQLPWKGLGGTISEKIGQLGSLRKLSLHNNVIAGSVPRSLGYLKSLRGVYLFNNRLSGSIPVSLGNCPLLQNLDLSSNQLTGAIPPSLTESTRLYRLNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSG 228          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.726e-24
Identity = 77/256 (30.08%), Postives = 113/256 (44.14%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXA--------------------NCKKLRDIGLTGNPLNGILPSSIGNLSMS--LKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLG-RLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            + FSG +P+       L+ L LGNNY                                   NC  LR + L+ N   G +PS   +L  S  L+ + I N  +SG +P  +G               TGPIP     L  L  L +  N L G+ P+ +C  G  L+ L+L  N L+GSIP  +S  T++  + L SNR T  IPS   +L  +      +N L G +   +GN K L+ ++L+ NNL+GD+P  +
Sbjct:  312 NTFSGELPSQFTACVWLQNLNLGNNYLSGDFLNTVVSKITGITYLYVAYNNISGSVPISLTNCSNLRVLDLSSNGFTGNVPSGFCSLQSSPVLEKILIANNYLSGTVPMELGKCKSLKTIDLSFNELTGPIPKEIWMLPNLSDLVMWANNLTGTIPEGVCVKGGNLETLILNNNLLTGSIPESISRCTNMIWISLSSNRLTGKIPSGIGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSNNLTGDLPGEL 567          

HSP 2 Score: 78.9518 bits (193), Expect = 4.363e-14
Identity = 64/214 (29.91%), Postives = 98/214 (45.79%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSS-IGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXX-TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCH-LGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            NCK L  + ++ N L G +P+        +LK L + +  +SG IP  +                 +G +P+ F     LQ L L  N L G F + +   +  +  L +  N +SGS+P  L+N ++LR L L SN FT  +PS F SL+                     +  VL  I ++ N LSG +P  +G  K L+ +DL++N L GP
Sbjct:  249 NCKFLETLNISRNNLAGKIPNGEYWGSFQNLKQLSLAHNRLSGEIPPELSLLCKTLVILDLSGNTFSGELPSQFTACVWLQNLNLGNNYLSGDFLNTVVSKITGITYLYVAYNNISGSVPISLTNCSNLRVLDLSSNGFTGNVPSGFCSLQ---------------------SSPVLEKILIANNYLSGTVPMELGKCKSLKTIDLSFNELTGP 441          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: EXS_ARATH (Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.650e-24
Identity = 84/284 (29.58%), Postives = 123/284 (43.31%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTG-------------------------------NPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +A+ F G IP  +G+  +L  L LG+N                 C  L    L+G                               N L+G +P  +G   + L  + + N  +SG IP S+                TG IP   G   KLQGL LA N+L G  P+    LG L KL L  NKL G +P+ L NL  L  + L  N  +  + S   +++ ++      N   G + S++GNL  L  +++SEN LSG++P  I GL +L+ ++LA N L G
Sbjct:  504 NANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGSIPSKPSAYFHQIEMPDLSFLQHHGIFDLSYNRLSGPIPEELGEC-LVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALTGSIPKEMGNSLKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEKLVGLYIEQNKFTGEIPSELGNLTQLEYLDVSENLLSGEIPTKICGLPNLEFLNLAKNNLRG 786          

HSP 2 Score: 107.071 bits (266), Expect = 1.496e-22
Identity = 82/268 (30.60%), Postives = 116/268 (43.28%), Query Frame = 2
Query:   26 IPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTS-----------------------LRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            IP + G L NL  L L +                 NCK L+ + L+ N L+G LP  +  +   L T       +SG++P  +G               +G IP        L+ L LA N L GS P ELC  G L+ + L GN LSG+I       +S                       L +L L SN FT  IP + W   +++ F  S N L G L ++IGN   L  + LS+N L+G++P  IG L  L +++L  N  +G
Sbjct:  250 IPKSFGELHNLSILNLVS-----AELIGLIPPELGNCKSLKSLMLSFNSLSGPLPLELSEIP--LLTFSAERNQLSGSLPSWMGKWKVLDSLLLANNRFSGEIPHEIEDCPMLKHLSLASNLLSGSIPRELCGSGSLEAIDLSGNLLSGTIEEVFDGCSSLGELLLTNNQINGSIPEDLWKLPLMALDLDSNNFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPREIGKLTSLSVLNLNANMFQG 510          

HSP 3 Score: 105.145 bits (261), Expect = 5.685e-22
Identity = 79/268 (29.48%), Postives = 127/268 (47.39%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTT----FGRLQ-------KLQGLY-LAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            G++P  IGN  +L+ L L +N                    L  + L  N   G +P  +G+ + SL TL +G+ ++ G IP  I                +G IP+     F +++       +  G++ L++N+L G  P+EL     L ++ L  N LSG IP+ LS LT+L  L L  N  T  IP    +   +   + ++N L G +    G L  L+ +NL++N L G +PA++G LK+L  MDL++N L G     + T+
Sbjct:  462 GYLPAEIGNAASLKRLVLSDNQLTGEIPREI-----GKLTSLSVLNLNANMFQGKIPVELGDCT-SLTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGSIPSKPSAYFHQIEMPDLSFLQHHGIFDLSYNRLSGPIPEELGECLVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALTGSIPKEMGNSLKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTM 723          

HSP 4 Score: 103.219 bits (256), Expect = 2.160e-21
Identity = 66/189 (34.92%), Postives = 99/189 (52.38%), Query Frame = 2
Query:  134 CKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPA 700
            C  L +I L+ N L+G +P+S+  L+ +L  L +   +++G+IP+ +G                G IP +FG L  L  L L  NKL G  P  L +L  L  + L  N LSG + S LS +  L  LY+  N+FT  IPS   +L  + + D S N L G + + I  L  L  +NL++NNL G++P+
Sbjct:  603 CLVLVEISLSNNHLSGEIPASLSRLT-NLTILDLSGNALTGSIPKEMGNSLKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEKLVGLYIEQNKFTGEIPSELGNLTQLEYLDVSENLLSGEIPTKICGLPNLEFLNLAKNNLRGEVPS 790          

HSP 5 Score: 98.2117 bits (243), Expect = 6.949e-20
Identity = 83/269 (30.86%), Postives = 112/269 (41.64%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNN--------------------YXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG IP  I NL++L+ L L  N                                    +   L  + ++ N L+G +P  IG LS +L  LY+G  S SG IP  IG                GP+P    +L+ L  L L++N L  S P     L  L  L L   +L G IP  L N  SL+SL L  N  +  +P     +  +L F    N L G L S +G  KVL  + L+ N  SG++P  I     L+ + LA N L G
Sbjct:  101 FSGKIPPEIWNLKHLQTLDLSGNSLTGLLPRLLSELPQLLYLDLSDNHFSGSLPPSFFISLPALSSLDVSNNSLSGEIPPEIGKLS-NLSNLYMGLNSFSGQIPSEIGNISLLKNFAAPSCFFNGPLPKEISKLKHLAKLDLSYNPLKCSIPKSFGELHNLSILNLVSAELIGLIPPELGNCKSLKSLMLSFNSLSGPLPLELSEI-PLLTFSAERNQLSGSLPSWMGKWKVLDSLLLANNRFSGEIPHEIEDCPMLKHLSLASNLLSG 367          

HSP 6 Score: 97.0561 bits (240), Expect = 1.548e-19
Identity = 64/205 (31.22%), Postives = 97/205 (47.32%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSD 631
            SG IP  +G    L  + L NN+              +    L  + L+GN L G +P  +GN S+ L+ L + N  ++G+IP+S G                GP+P + G L++L  + L+FN L G    EL  + +L  L +  NK +G IPS L NLT L  L +  N  +  IP+    L ++ F + + N L G + SD
Sbjct:  593 SGPIPEELGECLVLVEISLSNNHLSGEIPASL-----SRLTNLTILDLSGNALTGSIPKEMGN-SLKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEKLVGLYIEQNKFTGEIPSELGNLTQLEYLDVSENLLSGEIPTKICGLPNLEFLNLAKNNLRGEVPSD 791          

HSP 7 Score: 96.6709 bits (239), Expect = 2.022e-19
Identity = 81/262 (30.92%), Postives = 113/262 (43.13%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPA------------TIGGLKDLQIMDLAYNRLEGP 763
            FSG IP+ I +   L+ L L +N                    L  I L+GN L+G +       S SL  L + N  I+G+IP+ +                TG IP +  +   L     ++N+L G  P E+ +   L +LVL  N+L+G IP  +  LTSL  L L +N F   IP        +   D  SN L G +   I  L  L  + LS NNLSG +P+             +  L+   I DL+YNRL GP
Sbjct:  341 FSGEIPHEIEDCPMLKHLSLASNLLSGSIPREL-----CGSGSLEAIDLSGNLLSGTIEEVFDGCS-SLGELLLTNNQINGSIPEDL-WKLPLMALDLDSNNFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPREIGKLTSLSVLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGSIPSKPSAYFHQIEMPDLSFLQHHGIFDLSYNRLSGP 595          

HSP 8 Score: 90.5077 bits (223), Expect = 1.449e-17
Identity = 64/213 (30.05%), Postives = 99/213 (46.48%), Query Frame = 2
Query:  128 ANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFG-RLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            ++ K LR++ L GN  +G +P  I NL   L+TL +   S++G +P+ +                +G +P +F   L  L  L ++ N L G  P E+  L  L  L +  N  SG IPS + N++ L++    S  F   +P     LK +   D S N L   +    G L  L  +NL    L G +P  +G  K L+ + L++N L GP
Sbjct:   86 SSLKNLRELCLAGNQFSGKIPPEIWNLK-HLQTLDLSGNSLTGLLPRLLSELPQLLYLDLSDNHFSGSLPPSFFISLPALSSLDVSNNSLSGEIPPEIGKLSNLSNLYMGLNSFSGQIPSEIGNISLLKNFAAPSCFFNGPLPKEISKLKHLAKLDLSYNPLKCSIPKSFGELHNLSILNLVSAELIGLIPPELGNCKSLKSLMLSFNSLSGP 297          

HSP 9 Score: 88.1965 bits (217), Expect = 7.191e-17
Identity = 70/248 (28.23%), Postives = 104/248 (41.94%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXX-TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G IP  I +L+NL  L L  N                N K L+ + L+GN L G+LP  +  L   L  L + +   SG++P S                  +G IP   G+L  L  LY+  N   G  P E+ ++  L          +G +P  +S L  L  L L  N     IP +F  L ++   +  S  L+G +  ++GN K L  + LS N+LSG +P  +  +  L       N+L G
Sbjct:   79 GQIPKEISSLKNLRELCLAGNQFSGKIPPEIW-----NLKHLQTLDLSGNSLTGLLPRLLSELPQLLY-LDLSDNHFSGSLPPSFFISLPALSSLDVSNNSLSGEIPPEIGKLSNLSNLYMGLNSFSGQIPSEIGNISLLKNFAAPSCFFNGPLPKEISKLKHLAKLDLSYNPLKCSIPKSFGELHNLSILNLVSAELIGLIPPELGNCKSLKSLMLSFNSLSGPLPLELSEI-PLLTFSAERNQLSG 319          

HSP 10 Score: 73.9442 bits (180), Expect = 1.403e-12
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 2
Query:  419 CHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIG-GLKDLQIMDLAYNRLEG 760
            C LGR++ L L    L G IP  +S+L +LR L L  N+F+  IP   W+LK +   D S N L G L   +  L  LL ++LS+N+ SG +P +    L  L  +D++ N L G
Sbjct:   62 CLLGRVNSLSLPSLSLRGQIPKEISSLKNLRELCLAGNQFSGKIPPEIWNLKHLQTLDLSGNSLTGLLPRLLSELPQLLYLDLSDNHFSGSLPPSFFISLPALSSLDVSNNSLSG 176          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: HSL1_ARATH (Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.353e-23
Identity = 72/256 (28.12%), Postives = 114/256 (44.53%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            G IP ++G L N+  + L NN                N K LR +  + N L G +P  +  + +    LY  N  + G +P SI                TG +P   G    L+ L ++ N+  G  P +LC  G L++L++  N  SG IP  L++  SL  + L  NRF+  +P+ FW L  +   +  +N   G +S  IG    L  + LS N  +G +P  IG L +L  +  + N+  G     +++L
Sbjct:  243 GHIPPSLGGLTNVVQIELYNN-----SLTGEIPPELGNLKSLRLLDASMNQLTGKIPDELCRVPLESLNLYENN--LEGELPASIALSPNLYEIRIFGNRLTGGLPKDLGLNSPLRWLDVSENEFSGDLPADLCAKGELEELLIIHNSFSGVIPESLADCRSLTRIRLAYNRFSGSVPTGFWGLPHVNLLELVNNSFSGEISKSIGGASNLSLLILSNNEFTGSLPEEIGSLDNLNQLSASGNKFSGSLPDSLMSL 491          

HSP 2 Score: 102.834 bits (255), Expect = 2.821e-21
Identity = 68/193 (35.23%), Postives = 91/193 (47.15%), Query Frame = 2
Query:  128 ANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            A+C+ L  I L  N  +G +P+    L   +  L + N S SG I +SIG               TG +P   G L  L  L  + NK  GS PD L  LG L  L L GN+ SG + S + +   L  L L  N FT  IP    SL  + + D S N   G +   + +LK L  +NLS N LSGD+P ++
Sbjct:  393 ADCRSLTRIRLAYNRFSGSVPTGFWGLP-HVNLLELVNNSFSGEISKSIGGASNLSLLILSNNEFTGSLPEEIGSLDNLNQLSASGNKFSGSLPDSLMSLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNEFTGKIPDEIGSLSVLNYLDLSGNMFSGKIPVSLQSLK-LNQLNLSYNRLSGDLPPSL 583          

HSP 3 Score: 95.5153 bits (236), Expect = 4.504e-19
Identity = 82/273 (30.04%), Postives = 115/273 (42.12%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPT-------------------------TFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G  P+ I  L NL  L L NN               A CK L+ + L+ N L G LP ++ ++   +     GN + SG+IP S G                G IP                           FG L  L+ ++L    LVG  PD L  L +L  L L  N L G IP  L  LT++  + L +N  T  IP    +LK +   D S N L G +  ++  +  L  +NL ENNL G++PA+I    +L  + +  NRL G
Sbjct:   73 AGPFPSVICRLSNLAHLSLYNN-----SINSTLPLNIAACKSLQTLDLSQNLLTGELPQTLADIPTLVHLDLTGN-NFSGDIPASFGKFENLEVLSLVYNLLDGTIPPFLGNISTLKMLNLSYNPFSPSRIPPEFGNLTNLEVMWLTECHLVGQIPDSLGQLSKLVDLDLALNDLVGHIPPSLGGLTNVVQIELYNNSLTGEIPPELGNLKSLRLLDASMNQLTGKIPDELCRVP-LESLNLYENNLEGELPASIALSPNLYEIRIFGNRLTG 338          

HSP 4 Score: 91.2781 bits (225), Expect = 8.495e-18
Identity = 70/230 (30.43%), Postives = 108/230 (46.96%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTF------------------------GRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            LR + ++ N  +G LP+ +      L+ L I + S SG IP+S+                +G +PT F                        G    L  L L+ N+  GS P+E+  L  L++L   GNK SGS+P  L +L  L +L L  N+F+  + S   S K +   + + N   G +  +IG+L VL  ++LS N  SG +P ++  LK L  ++L+YNRL G
Sbjct:  350 LRWLDVSENEFSGDLPADLCAKG-ELEELLIIHNSFSGVIPESLADCRSLTRIRLAYNRFSGSVPTGFWGLPHVNLLELVNNSFSGEISKSIGGASNLSLLILSNNEFTGSLPEEIGSLDNLNQLSASGNKFSGSLPDSLMSLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNEFTGKIPDEIGSLSVLNYLDLSGNMFSGKIPVSLQSLK-LNQLNLSYNRLSG 577          

HSP 5 Score: 85.1149 bits (209), Expect = 6.088e-16
Identity = 66/252 (26.19%), Postives = 110/252 (43.65%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCK-KLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ +G IP  +GNL++L  L    N                 C+  L  + L  N L G LP+SI  LS +L  + I    ++G +P+ +G               +G +P       +L+ L +  N   G  P+ L     L ++ L  N+ SGS+P+    L  +  L L +N F+  I  +     ++     S+N   G L  +IG+L  L  ++ S N  SG +P ++  L +L  +DL  N+  G
Sbjct:  263 NSLTGEIPPELGNLKSLRLLDASMNQLTGKIPDEL-------CRVPLESLNLYENNLEGELPASIA-LSPNLYEIRIFGNRLTGGLPKDLGLNSPLRWLDVSENEFSGDLPADLCAKGELEELLIIHNSFSGVIPESLADCRSLTRIRLAYNRFSGSVPTGFWGLPHVNLLELVNNSFSGEISKSIGGASNLSLLILSNNEFTGSLPEEIGSLDNLNQLSASGNKFSGSLPDSLMSLGELGTLDLHGNQFSG 506          

HSP 6 Score: 73.559 bits (179), Expect = 1.833e-12
Identity = 39/111 (35.14%), Postives = 62/111 (55.86%), Query Frame = 2
Query:  464 LSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG---PXLXXIVTL 787
            L+G  PS +  L++L  L L +N   S +P    + K +   D S N L G L   + ++  L+ ++L+ NN SGD+PA+ G  ++L+++ L YN L+G   P L  I TL
Sbjct:   72 LAGPFPSVICRLSNLAHLSLYNNSINSTLPLNIAACKSLQTLDLSQNLLTGELPQTLADIPTLVHLDLTGNNFSGDIPASFGKFENLEVLSLVYNLLDGTIPPFLGNISTL 182          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: BRL3_ARATH (Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.014e-23
Identity = 73/256 (28.52%), Postives = 114/256 (44.53%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNN--------------------YXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMS--LKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELC-HLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            ++ +G +P +  +  +L+ L LGNN                    Y               NC  LR + L+ N   G +PS   +L  S  L+ L I N  +SG +P  +G               TG IP     L KL  L +  N L G  P+ +C   G L+ L+L  N L+GS+P  +S  T++  + L SN  T  IP     L+ +      +N L G + S++GN K L+ ++L+ NNL+G++P  +
Sbjct:  312 NSLTGQLPQSFTSCGSLQSLNLGNNKLSGDFLSTVVSKLSRITNLYLPFNNISGSVPISLTNCSNLRVLDLSSNEFTGEVPSGFCSLQSSSVLEKLLIANNYLSGTVPVELGKCKSLKTIDLSFNALTGLIPKEIWTLPKLSDLVMWANNLTGGIPESICVDGGNLETLILNNNLLTGSLPESISKCTNMLWISLSSNLLTGEIPVGIGKLEKLAILQLGNNSLTGNIPSELGNCKNLIWLDLNSNNLTGNLPGEL 567          

HSP 2 Score: 75.485 bits (184), Expect = 4.824e-13
Identity = 70/247 (28.34%), Postives = 106/247 (42.91%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGN-IPQSIGXXXXXXXXXXXXXXXTGPIPTT--FGRLQKLQGLYLAFNKLVGSFPDELCHLGR-LDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNR-------------------------FTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLK---VLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            L+ + L+GN + G        L  +L    +   SISG+  P S+                 G IP    +G  Q L+ L LA N   G  P EL  L R L+ L L GN L+G +P   ++  SL+SL LG+N+                          +  +P +  +  ++   D SSN   G + S   +L+   VL  + ++ N LSG +P  +G  K L+ +DL++N L G     I TL
Sbjct:  203 LKHLDLSGNNVTGDFSRLSFGLCENLTVFSLSQNSISGDRFPVSLSNCKLLETLNLSRNSLIGKIPGDDYWGNFQNLRQLSLAHNLYSGEIPPELSLLCRTLEVLDLSGNSLTGQLPQSFTSCGSLQSLNLGNNKLSGDFLSTVVSKLSRITNLYLPFNNISGSVPISLTNCSNLRVLDLSSNEFTGEVPSGFCSLQSSSVLEKLLIANNYLSGTVPVELGKCKSLKTIDLSFNALTGLIPKEIWTL 449          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y3804_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.496e-22
Identity = 77/251 (30.68%), Postives = 118/251 (47.01%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGL-GNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGN--IPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP+++G++ +L+ L L GN++               NC  LR + L+ N L G +PS++   S+ L +L +     SGN      I                +G IP     L  L+ L L  N+  G+ P ++     L+++ L  N  SG +P  L  L SL    + +N  +   P     +  ++  DFSSN L G L S I NL+ L  +NLSEN LSG++P ++   K+L I+ L  N   G
Sbjct:  137 SGQIPSSLGSITSLQHLDLTGNSFSGTLSDDLFN-----NCSSLRYLSLSHNHLEGQIPSTLFRCSV-LNSLNLSRNRFSGNPSFVSGIWRLERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGALPSDIGLCPHLNRVDLSSNHFSGELPRTLQKLKSLNHFDVSNNLLSGDFPPWIGDMTGLVHLDFSSNELTGKLPSSISNLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSG 381          

HSP 2 Score: 99.7525 bits (247), Expect = 2.388e-20
Identity = 74/254 (29.13%), Postives = 116/254 (45.67%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLR------------------DIGL-----TGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            ++  +G +P++I NLR+L+ L L  N                +CK+L                   D+GL     +GN L G +P     L  SL  L + + S++G+IP  +G                  +P     LQ L  L L  + L+GS P ++C    L  L L GN L+GSIP  + N +SL+ L L  N  T  IP +  +L+++      +N L G +  ++G+L+ LL +N+S N L G +P
Sbjct:  328 SNELTGKLPSSISNLRSLKDLNLSEN-----KLSGEVPESLESCKELMIVQLKGNDFSGNIPDGFFDLGLQEMDFSGNGLTGSIPRGSSRLFESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFNTRVPPEIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEANKLSGEIPKELGDLQNLLLVNVSFNRLIGRLP 576          

HSP 3 Score: 98.2117 bits (243), Expect = 6.949e-20
Identity = 76/251 (30.28%), Postives = 116/251 (46.22%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGR-LDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            FSG +P T+  L++L    + NN                +   L  +  + N L G LPSSI NL  SLK L +    +SG +P+S+                +G IP  F  L  LQ +  + N L GS P     L   L +L L  N L+GSIP  +     +R L L  N F + +P     L+++   D  ++ L+G + +DI   + L  + L  N+L+G +P  IG    L+++ L++N L GP
Sbjct:  283 FSGELPRTLQKLKSLNHFDVSNNLLSGDFPPWI-----GDMTGLVHLDFSSNELTGKLPSSISNLR-SLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSGNIPDGFFDLG-LQEMDFSGNGLTGSIPRGSSRLFESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFNTRVPPEIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGP 526          

HSP 4 Score: 86.2705 bits (212), Expect = 2.733e-16
Identity = 73/253 (28.85%), Postives = 114/253 (45.06%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSL-KDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +++ SG IP  I +L NL+ L L  N                 C  L  + L+ N  +G LP ++  L  SL    + N  +SG+ P  IG               TG +P++   L+ L+ L L+ NKL G  P+ L     L  + L GN  SG+IP    +L  L+ +    N  T  IP     L + ++  D S N L G +  ++G    +  +NLS N+ +  +P  I  L++L ++DL  + L G
Sbjct:  232 SNSLSGSIPLGILSLHNLKELQLQRNQFSGALPSDIGL-----CPHLNRVDLSSNHFSGELPRTLQKLK-SLNHFDVSNNLLSGDFPPWIGDMTGLVHLDFSSNELTGKLPSSISNLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSGNIPDGFFDL-GLQEMDFSGNGLTGSIPRGSSRLFESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFNTRVPPEIEFLQNLTVLDLRNSALIG 477          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
BRI1_SOLPE1.446e-2529.72Systemin receptor SR160 OS=Solanum peruvianum PE=1... [more]
PEPR2_ARATH1.888e-2529.48Leucine-rich repeat receptor-like protein kinase P... [more]
BRI1_SOLLC3.221e-2531.74Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]
Y2579_ARATH9.370e-2532.66Probably inactive leucine-rich repeat receptor-lik... [more]
IMK2_ARATH9.370e-2529.66Probably inactive leucine-rich repeat receptor-lik... [more]
BRL1_ARATH2.726e-2430.08Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]
EXS_ARATH4.650e-2429.58Leucine-rich repeat receptor protein kinase EXS OS... [more]
HSL1_ARATH1.353e-2328.13Receptor-like protein kinase HSL1 OS=Arabidopsis t... [more]
BRL3_ARATH3.014e-2328.52Receptor-like protein kinase BRI1-like 3 OS=Arabid... [more]
Y3804_ARATH1.496e-2230.68Probably inactive leucine-rich repeat receptor-lik... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top