EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: DR100_ARATH (DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 7.425e-22
Identity = 67/206 (32.52%), Postives = 101/206 (49.03%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            LR + L GN + G +P+ IG LS  L  L +    +SG IP S+                TG IP  FG L+ L  + L  N+L GS P+ +  + RL  L L  N + G IP  + N+  L  L L  N  T  IP +  S   +   + S N L G +    G+   L+ ++LS N+LSG +P ++   K +  +D+++N+L G
Sbjct:  137 LRILDLAGNKITGEIPAEIGKLS-KLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHNKLCG 341          

HSP 2 Score: 93.5893 bits (231), Expect = 1.712e-18
Identity = 58/171 (33.92%), Postives = 84/171 (49.12%), Query Frame = 2
Query:  248 ISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            I+G IP  I                TG IP   G+L KL  L LA N++ G  P  L  L  L  L L  N ++G IP+   +L  L  + LG N  T  IP +   ++ +   D S N + GP+   +GN+KVL  +NL  N+L+G +P ++     L + +L+ N LEG
Sbjct:  123 ITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEG 293          

HSP 3 Score: 92.4337 bits (228), Expect = 3.813e-18
Identity = 55/147 (37.41%), Postives = 81/147 (55.10%), Query Frame = 2
Query:  323 TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            TG IP     L  L+ L LA NK+ G  P E+  L +L  L L  N++SG IP+ L++L  L+ L L  N  T VIP+ F SLK +       N L G +   I  ++ L  ++LS+N++ G +P  +G +K L +++L  N L GP
Sbjct:  124 TGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGP 270          

HSP 4 Score: 86.2705 bits (212), Expect = 2.733e-16
Identity = 59/196 (30.10%), Postives = 90/196 (45.92%), Query Frame = 2
Query:  173 LNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + G +P  I +L+ SL+ L +    I+G IP  IG               +G IP +   L +L+ L L  N + G  P +   L  L +++L  N+L+GSIP  +S +  L  L L  N     IP    ++K +   +   N L GP+   + +   L   NLS N L G +P   G    L  +DL++N L G
Sbjct:  123 ITGEIPPCITSLA-SLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSG 317          

HSP 5 Score: 83.5741 bits (205), Expect = 1.771e-15
Identity = 49/148 (33.11%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  323 TGPIPTTFGRLQKLQGLYLA-FNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            +G I      L  L  L LA +  + G  P  +  L  L  L L GNK++G IP+ +  L+ L  L L  N+ +  IP++  SL ++   + + N + G + +D G+LK+L  + L  N L+G +P +I G++ L  +DL+ N +EGP
Sbjct:   99 SGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGP 246          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: BRI1_ARATH (Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 7.425e-22
Identity = 79/251 (31.47%), Postives = 116/251 (46.22%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSI--GXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            F G +P   G+   LE L L +N                  + L+ + L+ N  +G LP S+ NLS SL TL + + + SG I  ++                  TG IP T     +L  L+L+FN L G+ P  L  L +L  L L+ N L G IP  L  + +L +L L  N  T  IPS   +  ++ +   S+N L G +   IG L+ L  + LS N+ SG++PA +G  + L  +DL  N   G
Sbjct:  328 FYGAVPPFFGSCSLLESLALSSN----NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNG 574          

HSP 2 Score: 103.99 bits (258), Expect = 1.266e-21
Identity = 71/233 (30.47%), Postives = 116/233 (49.79%), Query Frame = 2
Query:   14 FSGFIP-NTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNG-ILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            FSG +P +T+  +R L+ L L  N               +    L  + L+ N  +G ILP+   N   +L+ LY+ N   +G IP ++                +G IP++ G L KL+ L L  N L G  P EL ++  L+ L+L  N L+G IPS LSN T+L  + L +NR T  IP     L+++     S+N   G + +++G+ + L+ ++L+ N  +G +PA +
Sbjct:  352 FSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS----LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM 580          

HSP 3 Score: 88.1965 bits (217), Expect = 7.191e-17
Identity = 79/297 (26.60%), Postives = 123/297 (41.41%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSN---------LTSLRSLYLGS------------------------NRFTSVIPS-------------TFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + F+G IP T+ N   L  L L  NY               +  KLRD+ L  N L G +P  +  +  +L+TL +    ++G IP  +                TG IP   GRL+ L  L L+ N   G+ P EL     L  L L  N  +G+IP+ +           +   R +Y+ +                        NR ++  P              TF +   ++F D S N L G +  +IG++  L  +NL  N++SG +P  +G L+ L I+DL+ N+L+G
Sbjct:  426 NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL-----GSLSKLRDLKLWLNMLEGEIPQELMYVK-TLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDG 716          

HSP 4 Score: 76.6406 bits (187), Expect = 2.165e-13
Identity = 76/277 (27.44%), Postives = 113/277 (40.79%), Query Frame = 2
Query:   14 FSG-FIPNTIGNLRN-LEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGP----LSSD--------IGNLKVLLGI--------------NLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG  +PN   N +N L+ L L NN               +NC +L  + L+ N L+G +PSS+G+LS  L+ L +    + G IPQ +                TG IP+       L  + L+ N+L G  P  +  L  L  L L  N  SG+IP+ L +  SL  L L +N F   IP+  +          ++NF+ G     + +D         GNL    GI              N++     G    T      +  +D++YN L G
Sbjct:  402 FSGPILPNLCQNPKNTLQELYLQNN-----GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSG----KIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSG 668          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: IKU2_ARATH (Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.654e-21
Identity = 77/275 (28.00%), Postives = 115/275 (41.82%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDEL------------------------CHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            S+ +G IP  I NL  L+ L L +N                  K LR + +  N L G LP    NL+ +L+     N S+ G++ + +                TG IP  FG  + L  L L  N+L G  P  L                        C  G +  L++  N+ +G  P   +   +L  L + +N  + +IPS  W L ++ F D +SN+  G L+ DIGN K L  ++LS N  SG +P  I G   L  ++L  N+  G
Sbjct:  207 SSITGKIPEGIKNLVRLQNLELSDNQISGEIPKEI-----VQLKNLRQLEIYSNDLTGKLPLGFRNLT-NLRNFDASNNSLEGDLSE-LRFLKNLVSLGMFENRLTGEIPKEFGDFKSLAALSLYRNQLTGKLPRRLGSWTAFKYIDVSENFLEGQIPPYMCKKGVMTHLLMLQNRFTGQFPESYAKCKTLIRLRVSNNSLSGMIPSGIWGLPNLQFLDLASNYFEGNLTGDIGNAKSLGSLDLSNNRFSGSLPFQISGANSLVSVNLRMNKFSG 474          

HSP 2 Score: 94.3597 bits (233), Expect = 1.003e-18
Identity = 78/245 (31.84%), Postives = 117/245 (47.76%), Query Frame = 2
Query:   32 NTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTG--PIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++I +L+ LE L LGNN                 C +LR + L  N  +G  P+ I +L + L+ L +    ISG  P S                  G  P P     L  LQ +YL+ + + G  P+ + +L RL  L L  N++SG IP  +  L +LR L + SN  T  +P  F +L ++  FD S+N L G L S++  LK L+ + + EN L+G++P   G  K L  + L  N+L G
Sbjct:   94 DSICDLKLLEKLVLGNN-----SLRGQIGTNLGKCNRLRYLDLGINNFSGEFPA-IDSLQL-LEFLSLNASGISGIFPWSSLKDLKRLSFLSVGDNRFGSHPFPREILNLTALQWVYLSNSSITGKIPEGIKNLVRLQNLELSDNQISGEIPKEIVQLKNLRQLEIYSNDLTGKLPLGFRNLTNLRNFDASNNSLEGDL-SELRFLKNLVSLGMFENRLTGEIPKEFGDFKSLAALSLYRNQLTG 330          

HSP 3 Score: 88.5817 bits (218), Expect = 5.506e-17
Identity = 66/255 (25.88%), Postives = 109/255 (42.75%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKK--LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + +  +G +P  +G+    +++ +  N+                CKK  +  + +  N   G  P S       ++ L + N S+SG IP  I                 G +    G  + L  L L+ N+  GS P ++     L  + L  NK SG +P     L  L SL L  N  +  IP +      ++  +F+ N L   +   +G+LK+L  +NLS N LSG +P  +  LK L ++DL+ N+L G
Sbjct:  324 YRNQLTGKLPRRLGSWTAFKYIDVSENFLEGQIPPYM-------CKKGVMTHLLMLQNRFTGQFPESYAKCKTLIR-LRVSNNSLSGMIPSGIWGLPNLQFLDLASNYFEGNLTGDIGNAKSLGSLDLSNNRFSGSLPFQISGANSLVSVNLRMNKFSGIVPESFGKLKELSSLILDQNNLSGAIPKSLGLCTSLVDLNFAGNSLSEEIPESLGSLKLLNSLNLSGNKLSGMIPVGLSALK-LSLLDLSNNQLTG 569          

HSP 4 Score: 88.1965 bits (217), Expect = 7.191e-17
Identity = 66/248 (26.61%), Postives = 111/248 (44.76%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP   G+ ++L  L L  N                +    + I ++ N L G +P  +    +    L + N   +G  P+S                 +G IP+    L  LQ L LA N   G+   ++ +   L  L L  N+ SGS+P  +S   SL S+ L  N+F+ ++P +F  LK++       N L G +   +G    L+ +N + N+LS ++P ++G LK L  ++L+ N+L G
Sbjct:  305 TGEIPKEFGDFKSLAALSLYRNQLTGKLPRRL-----GSWTAFKYIDVSENFLEGQIPPYMCKKGVMTHLLMLQN-RFTGQFPESYAKCKTLIRLRVSNNSLSGMIPSGIWGLPNLQFLDLASNYFEGNLTGDIGNAKSLGSLDLSNNRFSGSLPFQISGANSLVSVNLRMNKFSGIVPESFGKLKELSSLILDQNNLSGAIPKSLGLCTSLVDLNFAGNSLSEEIPESLGSLKLLNSLNLSGNKLSG 546          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: IMK3_ARATH (Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.160e-21
Identity = 77/252 (30.56%), Postives = 111/252 (44.05%), Query Frame = 2
Query:   11 AFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLG-RLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            +  G I   IG L+ L  L L +N                    LR + L  N L G +P+S+G +S  L+TL + N  +S  IP ++                +G IP +  R   LQ L L  N L G   D        L  L L  N LSG  P  L NLT L+      NR    +PS    L  +   D S N + G +   +GN+  L+ ++LS+N L+G++P +I  L+ L   +++YN L GP
Sbjct:  112 SLGGRISEKIGQLQALRKLSLHDNNLGGSIPMSLGLIP-----NLRGVQLFNNRLTGSIPASLG-VSHFLQTLDLSNNLLSEIIPPNLADSSKLLRLNLSFNSLSGQIPVSLSRSSSLQFLALDHNNLSGPILDTWGSKSLNLRVLSLDHNSLSGPFPFSLCNLTQLQDFSFSHNRIRGTLPSELSKLTKLRKMDISGNSVSGHIPETLGNISSLIHLDLSQNKLTGEIPISISDLESLNFFNVSYNNLSGP 357          

HSP 2 Score: 100.523 bits (249), Expect = 1.400e-20
Identity = 72/236 (30.51%), Postives = 112/236 (47.46%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFG-RLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            H +   G IP ++G + NL  + L NN                    L+ + L+ N L+ I+P ++ + S  L+ L +   S+SG IP S+                +GPI  T+G +   L+ L L  N L G FP  LC+L +L       N++ G++PS LS LT LR + +  N  +  IP T  ++  ++  D S N L G +   I +L+ L   N+S NNLSG +P  +
Sbjct:  133 HDNNLGGSIPMSLGLIPNLRGVQLFNNRLTGSIPASLGVSHF-----LQTLDLSNNLLSEIIPPNLADSSKLLR-LNLSFNSLSGQIPVSLSRSSSLQFLALDHNNLSGPILDTWGSKSLNLRVLSLDHNSLSGPFPFSLCNLTQLQDFSFSHNRIRGTLPSELSKLTKLRKMDISGNSVSGHIPETLGNISSLIHLDLSQNKLTGEIPISISDLESLNFFNVSYNNLSGPVPTLL 362          

HSP 3 Score: 74.7146 bits (182), Expect = 8.228e-13
Identity = 45/133 (33.83%), Postives = 69/133 (51.88%), Query Frame = 2
Query:  371 LYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXL 769
            + L +  L G   +++  L  L KL L  N L GSIP  L  + +LR + L +NR T  IP++      +   D S+N L   +  ++ +   LL +NLS N+LSG +P ++     LQ + L +N L GP L
Sbjct:  106 IQLPWKSLGGRISEKIGQLQALRKLSLHDNNLGGSIPMSLGLIPNLRGVQLFNNRLTGSIPASLGVSHFLQTLDLSNNLLSEIIPPNLADSSKLLRLNLSFNSLSGQIPVSLSRSSSLQFLALDHNNLSGPIL 238          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: HSL2_ARATH (LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.685e-21
Identity = 63/251 (25.10%), Postives = 115/251 (45.82%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ +G IP +IG L ++  + L +N                N  +LR+  ++ N L G LP  I   ++ L +  + +   +G +P  +                TG +P   G+  ++    ++ N+  G  P  LC+  +L K++ F N+LSG IP    +  SL  + +  N+ +  +P+ FW L        ++N L G +   I   + L  + +S NN SG +P  +  L+DL+++DL+ N   G
Sbjct:  254 NSLTGEIPESIGRLESVYQIELYDN-----RLSGKLPESIGNLTELRNFDVSQNNLTGELPEKIA--ALQLISFNLNDNFFTGGLPDVVALNPNLVEFKIFNNSFTGTLPRNLGKFSEISEFDVSTNRFSGELPPYLCYRRKLQKIITFSNQLSGEIPESYGDCHSLNYIRMADNKLSGEVPARFWELPLTRLELANNNQLQGSIPPSISKARHLSQLEISANNFSGVIPVKLCDLRDLRVIDLSRNSFLG 497          

HSP 2 Score: 93.2041 bits (230), Expect = 2.235e-18
Identity = 61/191 (31.94%), Postives = 93/191 (48.69%), Query Frame = 2
Query:  137 KKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXT-GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            +KLR + L  N   G +P S G L+ +L+ L +    +SG +P  +G                  PIP+T G L  L  L L  + LVG  PD + +L  L+ L L  N L+G IP  +  L S+  + L  NR +  +P +  +L ++  FD S N L G L   I  L+ L+  NL++N  +G +P  +
Sbjct:  147 RKLRVLELESNLFTGEIPQSYGRLT-ALQVLNLNGNPLSGIVPAFLGYLTELTRLDLAYISFDPSPIPSTLGNLSNLTDLRLTHSNLVGEIPDSIMNLVLLENLDLAMNSLTGEIPESIGRLESVYQIELYDNRLSGKLPESIGNLTELRNFDVSQNNLTGELPEKIAALQ-LISFNLNDNFFTGGLPDVV 335          

HSP 3 Score: 92.0485 bits (227), Expect = 4.980e-18
Identity = 67/251 (26.69%), Postives = 115/251 (45.82%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++F+G +P  +G    +    +  N                  +KL+ I    N L+G +P S G+   SL  + + +  +SG +P                    G IP +  + + L  L ++ N   G  P +LC L  L  + L  N   GSIPSC++ L +L  + +  N     IPS+  S  ++   + S+N L G +  ++G+L VL  ++LS N L+G++PA +  LK L   +++ N+L G
Sbjct:  349 NSFTGTLPRNLGKFSEISEFDVSTNRFSGELPPYLCYR-----RKLQKIITFSNQLSGEIPESYGDCH-SLNYIRMADNKLSGEVPARFWELPLTRLELANNNQLQGSIPPSISKARHLSQLEISANNFSGVIPVKLCDLRDLRVIDLSRNSFLGSIPSCINKLKNLERVEMQENMLDGEIPSSVSSCTELTELNLSNNRLRGGIPPELGDLPVLNYLDLSNNQLTGEIPAELLRLK-LNQFNVSDNKLYG 592          

HSP 4 Score: 86.2705 bits (212), Expect = 2.733e-16
Identity = 62/196 (31.63%), Postives = 89/196 (45.41%), Query Frame = 2
Query:  134 CKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGS-FPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLK 718
            C KL+++ L  N  +G LP         L+ L + +   +G IPQS G               +G +P   G L +L  L LA+     S  P  L +L  L  L L  + L G IP  + NL  L +L L  N  T  IP +   L+ +   +   N L G L   IGNL  L   ++S+NNL+G++P  I  L+
Sbjct:  122 CSKLQNLILNQNNFSGKLPEFSPEFR-KLRVLELESNLFTGEIPQSYGRLTALQVLNLNGNPLSGIVPAFLGYLTELTRLDLAYISFDPSPIPSTLGNLSNLTDLRLTHSNLVGEIPDSIMNLVLLENLDLAMNSLTGEIPESIGRLESVYQIELYDNRLSGKLPESIGNLTELRNFDVSQNNLTGELPEKIAALQ 316          

HSP 5 Score: 80.8777 bits (198), Expect = 1.148e-14
Identity = 64/209 (30.62%), Postives = 98/209 (46.89%), Query Frame = 2
Query:  137 KKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFT-SVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + L +I L+ N LNG + S+  +L   L+ L +   + SG +P+                  TG IP ++GRL  LQ L L                         GN LSG +P+ L  LT L  L L    F  S IPST  +L ++     + + LVG +   I NL +L  ++L+ N+L+G++P +IG L+ +  ++L  NRL G
Sbjct:   98 RTLINITLSQNNLNGTIDSAPLSLCSKLQNLILNQNNFSGKLPEFSPEFRKLRVLELESNLFTGEIPQSYGRLTALQVLNLN------------------------GNPLSGIVPAFLGYLTELTRLDLAYISFDPSPIPSTLGNLSNLTDLRLTHSNLVGEIPDSIMNLVLLENLDLAMNSLTGEIPESIGRLESVYQIELYDNRLSG 282          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1124_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.812e-21
Identity = 68/188 (36.17%), Postives = 93/188 (49.47%), Query Frame = 2
Query:  134 CKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            CK L+ + L  N LNG +P SIG +  SL  + +GN SI G IP+ IG                         L+ LQ L L    L+G  P+++ +   L +L + GN L G I   L NLT+++ L L  NR    IP    +L  + F D S N L GP+ S +G+L  L   N+S NNLSG +P
Sbjct:  307 CKSLKLLDLESNKLNGSIPGSIGKME-SLSVIRLGNNSIDGVIPRDIGS------------------------LEFLQVLNLHNLNLIGEVPEDISNCRVLLELDVSGNDLEGKISKKLLNLTNIKILDLHRNRLNGSIPPELGNLSKVQFLDLSQNSLSGPIPSSLGSLNTLTHFNVSYNNLSGVIP 469          

HSP 2 Score: 81.2629 bits (199), Expect = 8.791e-15
Identity = 57/204 (27.94%), Postives = 93/204 (45.59%), Query Frame = 2
Query:  152 IGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXT-GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            I ++ N L+G +P  I  LS SL+ L +     +G IP S+                  G IP +      L G   ++N L G  P  +C +  L+ + +  N LSG +   +     L  + LGSN F  + P    + K+I +F+ S N   G +   +   + L  ++ S N L+G +P  + G K L+++DL  N+L G
Sbjct:  120 INVSSNALSGPIPEFISELS-SLRFLDLSKNGFTGEIPVSLFKFCDKTKFVSLAHNNIFGSIPASIVNCNNLVGFDFSYNNLKGVLPPRICDIPVLEYISVRNNLLSGDVSEEIQKCQRLILVDLGSNLFHGLAPFAVLTFKNITYFNVSWNRFGGEIGEIVDCSESLEFLDASSNELTGRIPTGVMGCKSLKLLDLESNKLNG 322          

HSP 3 Score: 80.8777 bits (198), Expect = 1.148e-14
Identity = 64/234 (27.35%), Postives = 104/234 (44.44%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIP---TTFGRL---------------------QKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            NC  L     + N L G+LP  I ++ + L+ + + N  +SG++ + I                 G  P    TF  +                     + L+ L  + N+L G  P  +     L  L L  NKL+GSIP  +  + SL  + LG+N    VIP    SL+ +   +  +  L+G +  DI N +VLL +++S N+L G +   +  L +++I+DL  NRL G
Sbjct:  186 NCNNLVGFDFSYNNLKGVLPPRICDIPV-LEYISVRNNLLSGDVSEEIQKCQRLILVDLGSNLFHGLAPFAVLTFKNITYFNVSWNRFGGEIGEIVDCSESLEFLDASSNELTGRIPTGVMGCKSLKLLDLESNKLNGSIPGSIGKMESLSVIRLGNNSIDGVIPRDIGSLEFLQVLNLHNLNLIGEVPEDISNCRVLLELDVSGNDLEGKISKKLLNLTNIKILDLHRNRLNG 418          

HSP 4 Score: 69.3218 bits (168), Expect = 3.457e-11
Identity = 45/132 (34.09%), Postives = 72/132 (54.55%), Query Frame = 2
Query:  392 LVGSFPDELCH-LGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKD-LQIMDLAYNRLEGPXLXXIV 781
            L  SF    C+  G +DK+VL+   L+G++   LSNL  +R L L  NRFT  +P  ++ L+ +   + SSN L GP+   I  L  L  ++LS+N  +G++P ++    D  + + LA+N + G     IV
Sbjct:   54 LCNSFNGITCNPQGFVDKIVLWNTSLAGTLAPGLSNLKFIRVLNLFGNRFTGNLPLDYFKLQTLWTINVSSNALSGPIPEFISELSSLRFLDLSKNGFTGEIPVSLFKFCDKTKFVSLAHNNIFGSIPASIV 185          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: BRL2_ARATH (Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 8.209e-21
Identity = 75/274 (27.37%), Postives = 124/274 (45.26%), Query Frame = 2
Query:   17 SGFIPNTIGNL-RNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXX-------------------------TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G+IP  IG+  R+L+ L L  N               ++C  L+ + L+ N ++G  P++I     SL+ L + N  ISG+ P SI                                         TG IP    +  +L+ + L+ N L G+ P E+ +L +L++ + + N ++G IP  +  L +L+ L L +N+ T  IP  F++  +I +  F+SN L G +  D G L  L  + L  NN +G++P  +G    L  +DL  N L G
Sbjct:  265 TGWIPPEIGDTCRSLQNLRLSYN-----NFTGVIPESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISGDFPTSISACKSLRIADFSSNRFSGVIPPDLCPGAASLEELRLPDNLVTGEIPPAISQCSELRTIDLSLNYLNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDLILNNNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRLAVLQLGNNNFTGEIPPELGKCTTLVWLDLNTNHLTG 533          

HSP 2 Score: 98.5969 bits (244), Expect = 5.321e-20
Identity = 64/232 (27.59%), Postives = 106/232 (45.69%), Query Frame = 2
Query:   17 SGFIPNTI-GNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIG 709
            SG  PNTI  +  +L+ L L NN               + CK LR    + N  +G++P  +   + SL+ L + +  ++G IP +I                 G IP   G LQKL+     +N + G  P E+  L  L  L+L  N+L+G IP    N +++  +   SNR T  +P  F  L  +      +N   G +  ++G    L+ ++L+ N+L+G++P  +G
Sbjct:  314 SGPFPNTILRSFGSLQILLLSNNLISGDFPTSI-----SACKSLRIADFSSNRFSGVIPPDLCPGAASLEELRLPDNLVTGEIPPAISQCSELRTIDLSLNYLNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDLILNNNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRLAVLQLGNNNFTGEIPPELGKCTTLVWLDLNTNHLTGEIPPRLG 540          

HSP 3 Score: 95.1301 bits (235), Expect = 5.883e-19
Identity = 75/253 (29.64%), Postives = 113/253 (44.66%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGR-LQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCL-SNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ SG+I +++ N  NL+ L L  N                  K L+ + L+ N L G +P  IG+   SL+ L +   + +G IP+S+                +GP P T  R    LQ L L+ N + G FP  +     L       N+ SG IP  L     SL  L L  N  T  IP       ++   D S N+L G +  +IGNL+ L       NN++G++P  IG L++L+ + L  N+L G
Sbjct:  214 NSISGYISDSLINCTNLKSLNLSYN-----NFDGQIPKSFGELKLLQSLDLSHNRLTGWIPPEIGDTCRSLQNLRLSYNNFTGVIPESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISGDFPTSISACKSLRIADFSSNRFSGVIPPDLCPGAASLEELRLPDNLVTGEIPPAISQCSELRTIDLSLNYLNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDLILNNNQLTG 461          

HSP 4 Score: 95.1301 bits (235), Expect = 5.883e-19
Identity = 81/251 (32.27%), Postives = 114/251 (45.42%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRL---QKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP  IG L+NL+ L L NN                NC  +  +  T N L G +P   G LS  L  L +GN + +G IP  +G               TG IP   GR    + L GL      L G+    + ++G   K V    + SG  P  L  + SL+S    +  ++  I S F   + I + D S N L G +  +IG +  L  + LS N LSG++P TIG LK+L + D + NRL+G
Sbjct:  436 AGEIPPEIGKLQNLKDLILNNNQLTGEIPPEFF-----NCSNIEWVSFTSNRLTGEVPKDFGILSR-LAVLQLGNNNFTGEIPPELGKCTTLVWLDLNTNHLTGEIPPRLGRQPGSKALSGL------LSGNTMAFVRNVGNSCKGVGGLVEFSGIRPERLLQIPSLKSCDF-TRMYSGPILSLFTRYQTIEYLDLSYNQLRGKIPDEIGEMIALQVLELSHNQLSGEIPFTIGQLKNLGVFDASDNRLQG 673          

HSP 5 Score: 76.6406 bits (187), Expect = 2.165e-13
Identity = 58/192 (30.21%), Postives = 89/192 (46.35%), Query Frame = 2
Query:  206 LSMSLKTLYIGNCSISGNIPQSI-GXXXXXXXXXXXXXXXTGPIPTT-FGRLQKLQGLYLAFNKLVGSFPDELCHLGR---LDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGN-LKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            L ++L  L + +  + G +P++                  TG +P   F   +KLQ L L++N + G        L     +  L   GN +SG I   L N T+L+SL L  N F   IP +F  LK +   D S N L G +  +IG+  + L  + LS NN +G +P ++     LQ +DL+ N + GP
Sbjct:  125 LPLTLTHLELSSSGLIGTLPENFFSKYSNLISITLSYNNFTGKLPNDLFLSSKKLQTLDLSYNNITGPISGLTIPLSSCVSMTYLDFSGNSISGYISDSLINCTNLKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHNRLTGWIPPEIGDTCRSLQNLRLSYNNFTGVIPESLSSCSWLQSLDLSNNNISGP 316          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PSKR2_ARATH (Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.072e-20
Identity = 73/249 (29.32%), Postives = 111/249 (44.58%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNI-PQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            G +P  I  L  L+ L L +N               +  K ++ + ++ N L+G L S +G +   L  L + N    G I P+                   G +   +   + +Q L++  N+L G  PD L  +  L++L L GN LSG +   LSNL+ L+SL +  NRF+ VIP  F +L  +   D SSN   G     +     L  ++L  N+LSG +     G  DL ++DLA N   GP
Sbjct:  102 GEVPAEISKLEQLQVLDLSHNLLSGSVLGVV-----SGLKLIQSLNISSNSLSGKL-SDVG-VFPGLVMLNVSNNLFEGEIHPELCSSSGGIQVLDLSMNRLVGNLDGLYNCSKSIQQLHIDSNRLTGQLPDYLYSIRELEQLSLSGNYLSGELSKNLSNLSGLKSLLISENRFSDVIPDVFGNLTQLEHLDVSSNKFSGRFPPSLSQCSKLRVLDLRNNSLSGSINLNFTGFTDLCVLDLASNHFSGP 343          

HSP 2 Score: 86.6557 bits (213), Expect = 2.092e-16
Identity = 71/239 (29.71%), Postives = 102/239 (42.68%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLV--GSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDL 724
            FS  IP+  GNL  LE L + +N               + C KLR + L  N L+G +  +    +  L  L + +   SG +P S+G                G IP TF  LQ L  L L+ N  V      + L H   L  L+L  N +   IP+ ++   +L  L LG+      IPS   + K +   D S N   G +   IG ++ L  I+ S N L+G +P  I  LK+L
Sbjct:  268 FSDVIPDVFGNLTQLEHLDVSSN-----KFSGRFPPSLSQCSKLRVLDLRNNSLSGSINLNFTGFT-DLCVLDLASNHFSGPLPDSLGHCPKMKILSLAKNEFRGKIPDTFKNLQSLLFLSLSNNSFVDFSETMNVLQHCRNLSTLILSKNFIGEEIPNNVTGFDNLAILALGNCGLRGQIPSWLLNCKKLEVLDLSWNHFYGTIPHWIGKMESLFYIDFSNNTLTGAIPVAITELKNL 500          

HSP 3 Score: 86.2705 bits (212), Expect = 2.733e-16
Identity = 68/249 (27.31%), Postives = 115/249 (46.18%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            F G IP+T  NL++L +L L NN                +C+ L  + L+ N +   +P+++     +L  L +GNC + G IP  +                 G IP   G+++ L  +  + N L G+ P  +  L  L +L    ++++ S    L    +  S  L  N+ +   PS +           ++N L G +  +IG LK L  ++LS NN +G +P +I GL +L+++DL+YN L G
Sbjct:  364 FRGKIPDTFKNLQSLLFLSLSNN---SFVDFSETMNVLQHCRNLSTLILSKNFIGEEIPNNVTGFD-NLAILALGNCGLRGQIPSWLLNCKKLEVLDLSWNHFYGTIPHWIGKMESLFYIDFSNNTLTGAIPVAITELKNLIRLNGTASQMTDSSGIPLYVKRNKSSNGLPYNQVSRFPPSIY----------LNNNRLNGTILPEIGRLKELHMLDLSRNNFTGTIPDSISGLDNLEVLDLSYNHLYG 598          

HSP 4 Score: 72.7886 bits (177), Expect = 3.127e-12
Identity = 61/237 (25.74%), Postives = 100/237 (42.19%), Query Frame = 2
Query:  131 NCKK-LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSI------------------------PSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLV--GPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            NC K ++ + +  N L G LP  + ++   L+ L +    +SG + +++                +  IP  FG L +L+ L ++ NK  G FP  L    +L  L L  N LSGSI                        P  L +   ++ L L  N F   IP TF +L+ +LF   S+N  V      + + + + L  + LS+N +  ++P  + G  +L I+ L    L G
Sbjct:  205 NCSKSIQQLHIDSNRLTGQLPDYLYSIR-ELEQLSLSGNYLSGELSKNLSNLSGLKSLLISENRFSDVIPDVFGNLTQLEHLDVSSNKFSGRFPPSLSQCSKLRVLDLRNNSLSGSINLNFTGFTDLCVLDLASNHFSGPLPDSLGHCPKMKILSLAKNEFRGKIPDTFKNLQSLLFLSLSNNSFVDFSETMNVLQHCRNLSTLILSKNFIGEEIPNNVTGFDNLAILALGNCGLRG 440          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5614_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 5.321e-20
Identity = 80/277 (28.88%), Postives = 117/277 (42.24%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLG------------------------SNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +A    G IP  +  L  L  L LG N                N  ++R +    N L+G +P  IG L+  L+ L I + + SG+IP  IG               +G +P +F  L +L+  ++A  +L G  PD +    +L  L + G  LSG IP+  SNLTSL  L LG                        +N  T  IPS       +   D S N L G + + + NL+ L  + L  N L+G +P   G  + L  +D++YN L G
Sbjct:  106 YAMEVVGSIPQQLWTLEYLTNLNLGQNVLTGSLPPAL-----GNLTRMRWMTFGINALSGPIPKEIGLLT-DLRLLSISSNNFSGSIPDEIGRCTKLQQIYIDSSGLSGGLPVSFANLVELEQAWIADMELTGQIPDFIGDWTKLTTLRILGTGLSGPIPASFSNLTSLTELRLGDISNGNSSLEFIKDMKSLSILVLRNNNLTGTIPSNIGEYSSLRQLDLSFNKLHGTIPASLFNLRQLTHLFLGNNTLNGSLPTQKG--QSLSNVDVSYNDLSG 374          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1743_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 5.321e-20
Identity = 66/212 (31.13%), Postives = 97/212 (45.75%), Query Frame = 2
Query:  128 ANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGR-------------------------LQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSG 688
            +NC+ L  + L GN   G +P+ IG++S SLK LY+GN + S +IP+++                 G I   FGR                         L  L  L L +N   G  P E+  +  L  L+L  N  SG IP    N+  L++L L  N+ T  IP++F  L  +L+   ++N L G +  +IGN   LL  N++ N LSG
Sbjct:  273 SNCQNLNVLNLWGNKFTGNIPAEIGSIS-SLKGLYLGNNTFSRDIPETLLNLTNLVFLDLSRNKFGGDIQEIFGRFTQVKYLVLHANSYVGGINSSNILKLPNLSRLDLGYNNFSGQLPTEISQIQSLKFLILAYNNFSGDIPQEYGNMPGLQALDLSFNKLTGSIPASFGKLTSLLWLMLANNSLSGEIPREIGNCTSLLWFNVANNQLSG 483          

HSP 2 Score: 89.7373 bits (221), Expect = 2.472e-17
Identity = 76/298 (25.50%), Postives = 121/298 (40.60%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQK----------------------LQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSN-------------------------FLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +   G IP+ +    NL+ L L +N                    L  + L+ N + G + SS      SL    +   + +G I                    +G + T FGRL +                      LQ L L+ N   G FP ++ +   L+ L L+GNK +G+IP+ + +++SL+ LYLG+N F+  IP T  +L +++F D S N                         ++ G  SS+I  L  L  ++L  NN SG +P  I  ++ L+ + LAYN   G
Sbjct:  121 NTIEGEIPDDLSRCHNLKHLNLSHNILEGELSLP-------GLSNLEVLDLSLNRITGDIQSSFPLFCNSLVVANLSTNNFTGRIDDIFNGCRNLKYVDFSSNRFSGEVWTGFGRLVEFSVADNHLSGNISASMFRGNCTLQMLDLSGNAFGGEFPGQVSNCQNLNVLNLWGNKFTGNIPAEIGSISSLKGLYLGNNTFSRDIPETLLNLTNLVFLDLSRNKFGGDIQEIFGRFTQVKYLVLHANSYVGGINSSNILKLPNLSRLDLGYNNFSGQLPTEISQIQSLKFLILAYNNFSG 411          

HSP 3 Score: 77.411 bits (189), Expect = 1.269e-13
Identity = 68/253 (26.88%), Postives = 102/253 (40.32%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQK--LQGLYLAFNKLVGSFPDELCHLGRLDK-------LVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYN 748
            +G IP + G L +L WL L NN                NC  L    +  N L+G     +  +  +    +  N      I    G                 P    +  L K   + L+    K  G FP  +C  G   +       L L GNK SG IP+ +S +  L +L+LG N F   +P     L  + F + + N   G +  +IGNLK L  ++LS NN SG+ P ++  L +L   +++YN
Sbjct:  434 TGSIPASFGKLTSLLWLMLANN-----SLSGEIPREIGNCTSLLWFNVANNQLSGRFHPELTRMGSNPSPTFEVNRQNKDKIIAGSGECLAMKRWIPAEFP---PFNFVYAILTKKSCRSLWDHVLKGYGLFP--VCSAGSTVRTLKISAYLQLSGNKFSGEIPASISQMDRLSTLHLGFNEFEGKLPPEIGQLP-LAFLNLTRNNFSGEIPQEIGNLKCLQNLDLSFNNFSGNFPTSLNDLNELSKFNISYN 675          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
DR100_ARATH7.425e-2232.52DNA-damage-repair/toleration protein DRT100 OS=Ara... [more]
BRI1_ARATH7.425e-2231.47Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidops... [more]
IKU2_ARATH1.654e-2128.00Receptor-like protein kinase HAIKU2 OS=Arabidopsis... [more]
IMK3_ARATH2.160e-2130.56Probable leucine-rich repeat receptor-like protein... [more]
HSL2_ARATH3.685e-2125.10LRR receptor-like serine/threonine-protein kinase ... [more]
Y1124_ARATH4.812e-2136.17Probable LRR receptor-like serine/threonine-protei... [more]
BRL2_ARATH8.209e-2127.37Serine/threonine-protein kinase BRI1-like 2 OS=Ara... [more]
PSKR2_ARATH1.072e-2029.32Phytosulfokine receptor 2 OS=Arabidopsis thaliana ... [more]
Y5614_ARATH5.321e-2028.88Probable LRR receptor-like serine/threonine-protei... [more]
Y1743_ARATH5.321e-2031.13Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top