EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC1_COLGL (Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletotrichum gloeosporioides GN=UBC1 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.562e-38
Identity = 43/56 (76.79%), Postives = 52/56 (92.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF +AI+FP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISK++
Sbjct:   48 GVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVL 103          

HSP 2 Score: 79.7221 bits (195), Expect = 3.562e-38
Identity = 35/46 (76.09%), Postives = 39/46 (84.78%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MA KRI KEL DL +DPP+SCSAGP  ED+FHWQATIMGP DSPY+
Sbjct:    1 MAFKRINKELTDLGRDPPSSCSAGPVGEDLFHWQATIMGPGDSPYS 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC4_YEAST (Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae GN=UBC4 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.562e-38
Identity = 40/56 (71.43%), Postives = 53/56 (94.64%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF ++I+FP DYPFKPPK++F TK++HPNIN+NG+ICLDILK+QWSPALT+SK++
Sbjct:   49 GVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVL 104          

HSP 2 Score: 80.8777 bits (198), Expect = 3.562e-38
Identity = 33/45 (73.33%), Postives = 41/45 (91.11%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +SKRI KEL DL++DPPTSCSAGP  +D++HWQA+IMGP+DSPYA
Sbjct:    3 SSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYA 47          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 6.045e-38
Identity = 42/56 (75.00%), Postives = 52/56 (92.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF ++I+FP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISK++
Sbjct:   48 GVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVL 103          

HSP 2 Score: 80.1073 bits (196), Expect = 6.045e-38
Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MA KRI +EL DL KDPP+SCSAGP  +D+FHWQATIMGP+DSPYA
Sbjct:    1 MALKRINRELADLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPYA 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D3_RAT (Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus GN=Ube2d3 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D3_PONAB (Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D3_MOUSE (Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus GN=Ube2d3 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D3_MACFA (Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fascicularis GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D3_HUMAN (Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens GN=UBE2D3 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D2_XENLA (Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laevis GN=ube2d2 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D2_RAT (Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus GN=Ube2d2 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBC1_COLGL3.562e-3876.79Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletot... [more]
UBC4_YEAST3.562e-3871.43Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces... [more]
UBC4_SCHPO6.045e-3875.00Ubiquitin-conjugating enzyme E2 4 OS=Schizosacchar... [more]
UB2D3_RAT7.876e-3876.79Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norve... [more]
UB2D3_PONAB7.876e-3876.79Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii... [more]
UB2D3_MOUSE7.876e-3876.79Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus... [more]
UB2D3_MACFA7.876e-3876.79Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fasci... [more]
UB2D3_HUMAN7.876e-3876.79Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens... [more]
UB2D2_XENLA7.876e-3876.79Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laev... [more]
UB2D2_RAT7.876e-3876.79Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norve... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top