EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROMO (Ubiquitin-conjugating enzyme E2 S OS=Drosophila mojavensis GN=GI11085 PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.003e-13
Identity = 25/56 (44.64%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G+F V +    D+P  PPK  F TK+FHPN+ +NG IC++ LK+ W P L I  ++
Sbjct:   61 GIFRVKLTLSKDFPQTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 33.4982 bits (75), Expect = 4.003e-13
Identity = 15/43 (34.88%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            ++++KEL+D++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMKELQDMETTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROSI (Ubiquitin-conjugating enzyme E2 S OS=Drosophila simulans GN=GD17343 PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 5.197e-13
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  335 AGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            AG+F V +    D+P  PPK  F TK+FHPN+ +NG IC++ LK+ W P L I  ++
Sbjct:   60 AGIFRVKLTLNKDFPLTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 30.8018 bits (68), Expect = 5.197e-13
Identity = 13/43 (30.23%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++++EL++++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROSE (Ubiquitin-conjugating enzyme E2 S OS=Drosophila sechellia GN=GM13299 PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 5.197e-13
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  335 AGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            AG+F V +    D+P  PPK  F TK+FHPN+ +NG IC++ LK+ W P L I  ++
Sbjct:   60 AGIFRVKLTLNKDFPLTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 30.8018 bits (68), Expect = 5.197e-13
Identity = 13/43 (30.23%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++++EL++++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROME (Ubiquitin-conjugating enzyme E2 S OS=Drosophila melanogaster GN=CG8188 PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 5.197e-13
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  335 AGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            AG+F V +    D+P  PPK  F TK+FHPN+ +NG IC++ LK+ W P L I  ++
Sbjct:   60 AGIFRVKLTLNKDFPLTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 30.8018 bits (68), Expect = 5.197e-13
Identity = 13/43 (30.23%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++++EL++++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC15_SCHPO (Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe GN=ubc15 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 6.833e-13
Identity = 20/42 (47.62%), Postives = 30/42 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 463
            G F   ++FP DYP  PPK+ F T+++HPN++ NG +C+ IL
Sbjct:   53 GFFHATLSFPQDYPLMPPKMKFTTEIWHPNVHPNGEVCISIL 94          

HSP 2 Score: 38.891 bits (89), Expect = 6.833e-13
Identity = 19/46 (41.30%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  195 ASKRIL-KELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            AS+++L K+LK++QK+PP   S G   +  +F W+  I+GP D+ Y
Sbjct:    5 ASEQLLRKQLKEIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLY 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROYA (Ubiquitin-conjugating enzyme E2 S OS=Drosophila yakuba GN=GE15576 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 8.768e-13
Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  335 AGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            AGVF V +    D+P  PPK  F TK+FHPN+ +NG IC++ LK+ W P L I  ++
Sbjct:   60 AGVFRVKLTLNKDFPQTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 30.8018 bits (68), Expect = 8.768e-13
Identity = 13/43 (30.23%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++++EL++++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROER (Ubiquitin-conjugating enzyme E2 S OS=Drosophila erecta GN=GG18165 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 8.768e-13
Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  335 AGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            AGVF V +    D+P  PPK  F TK+FHPN+ +NG IC++ LK+ W P L I  ++
Sbjct:   60 AGVFRVKLTLNKDFPQTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 30.8018 bits (68), Expect = 8.768e-13
Identity = 13/43 (30.23%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++++EL++++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_RANCA (Ubiquitin-conjugating enzyme E2 S OS=Rana catesbeiana GN=ube2s PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 8.768e-13
Identity = 24/52 (46.15%), Postives = 35/52 (67.31%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G+F + +    D+P  PPK  F TK+FHPN++SNG IC+++LK+ W   L I
Sbjct:   58 GIFRMKLILGKDFPAAPPKGYFLTKIFHPNVSSNGEICVNVLKKDWKAELGI 109          

HSP 2 Score: 35.039 bits (79), Expect = 8.768e-13
Identity = 16/43 (37.21%), Postives = 23/43 (53.49%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++ KE+  L  DPP      P  ED+   Q +I GP  +PYA
Sbjct:   14 RQVYKEVSTLTPDPPEGIKIIPNEEDITDVQVSIEGPEGTPYA 56          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2C_DROME (Ubiquitin-conjugating enzyme E2 C OS=Drosophila melanogaster GN=vih PE=1 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 8.847e-13
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 2
Query:  332 YAG-VFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWS 478
            Y+G  + ++++FP  YP+  P V F T  FHPN++  G+ICLDILK++WS
Sbjct:   76 YSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDILKDKWS 125          

HSP 2 Score: 36.1946 bits (82), Expect = 8.847e-13
Identity = 18/44 (40.91%), Postives = 25/44 (56.82%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            SKR+ KEL +L        SA P  E++F W  TI GP ++ Y+
Sbjct:   34 SKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYS 77          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_HUMAN (Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens GN=UBE2S PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 1.136e-12
Identity = 23/52 (44.23%), Postives = 34/52 (65.38%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G+F + +    D+P  PPK  F TK+FHPN+ +NG IC+++LK  W+  L I
Sbjct:   58 GLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGI 109          

HSP 2 Score: 36.5798 bits (83), Expect = 1.136e-12
Identity = 17/41 (41.46%), Postives = 21/41 (51.22%), Query Frame = 3
Query:  207 ILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            + KE+  L  DPP      P  ED+   Q TI GP  +PYA
Sbjct:   16 VYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYA 56          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBE2S_DROMO4.003e-1344.64Ubiquitin-conjugating enzyme E2 S OS=Drosophila mo... [more]
UBE2S_DROSI5.197e-1345.61Ubiquitin-conjugating enzyme E2 S OS=Drosophila si... [more]
UBE2S_DROSE5.197e-1345.61Ubiquitin-conjugating enzyme E2 S OS=Drosophila se... [more]
UBE2S_DROME5.197e-1345.61Ubiquitin-conjugating enzyme E2 S OS=Drosophila me... [more]
UBC15_SCHPO6.833e-1347.62Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccha... [more]
UBE2S_DROYA8.768e-1347.37Ubiquitin-conjugating enzyme E2 S OS=Drosophila ya... [more]
UBE2S_DROER8.768e-1347.37Ubiquitin-conjugating enzyme E2 S OS=Drosophila er... [more]
UBE2S_RANCA8.768e-1346.15Ubiquitin-conjugating enzyme E2 S OS=Rana catesbei... [more]
UBE2C_DROME8.847e-1348.00Ubiquitin-conjugating enzyme E2 C OS=Drosophila me... [more]
UBE2S_HUMAN1.136e-1244.23Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top