EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_BOVIN (Ubiquitin-conjugating enzyme E2 S OS=Bos taurus GN=UBE2S PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.136e-12
Identity = 23/52 (44.23%), Postives = 34/52 (65.38%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G+F + +    D+P  PPK  F TK+FHPN+ +NG IC+++LK  W+  L I
Sbjct:   58 GLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGI 109          

HSP 2 Score: 36.5798 bits (83), Expect = 1.136e-12
Identity = 17/41 (41.46%), Postives = 21/41 (51.22%), Query Frame = 3
Query:  207 ILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            + KE+  L  DPP      P  ED+   Q TI GP  +PYA
Sbjct:   16 VYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYA 56          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROAN (Ubiquitin-conjugating enzyme E2 S OS=Drosophila ananassae GN=GF21161 PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.139e-12
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  335 AGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            AG+F V +    D+P  PPK  F TK+FHPN+ +NG IC++ LK+ W P L I  ++
Sbjct:   60 AGIFRVKLTLNKDFPQTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 30.8018 bits (68), Expect = 1.139e-12
Identity = 13/43 (30.23%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++++EL++++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2SB_XENLA (Ubiquitin-conjugating enzyme E2 S-B OS=Xenopus laevis GN=ube2s-B PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.139e-12
Identity = 23/52 (44.23%), Postives = 35/52 (67.31%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G+F + +    D+P  PPK  F TK+FHPN+++NG IC+++LK+ W   L I
Sbjct:   58 GMFRMKLILGKDFPAAPPKGYFLTKIFHPNVSNNGEICVNVLKKDWKAELGI 109          

HSP 2 Score: 36.5798 bits (83), Expect = 1.139e-12
Identity = 17/43 (39.53%), Postives = 22/43 (51.16%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +R+ KE+  L  DPP      P  ED+   Q  I GP  +PYA
Sbjct:   14 RRVYKEVSTLTSDPPEGIKIIPNEEDITDVQVNIEGPEGTPYA 56          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROWI (Ubiquitin-conjugating enzyme E2 S OS=Drosophila willistoni GN=GK16201 PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.480e-12
Identity = 26/56 (46.43%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF V +    D+P  PPK  F TK+FHPN+ +NG IC++ LK+ W P L I  ++
Sbjct:   61 GVFRVKLTLSKDFPQTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 31.187 bits (69), Expect = 1.480e-12
Identity = 13/43 (30.23%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++++EL++++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMRELQEMENTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC20_ARATH (Ubiquitin carrier protein E2 20 OS=Arabidopsis thaliana GN=UBC20 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.491e-12
Identity = 26/50 (52.00%), Postives = 38/50 (76.00%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            + ++++F  DYPFKPPKV F T  FHPN++  G+ICLDIL+++WS A  +
Sbjct:   84 YRLSLSFSNDYPFKPPKVKFETCCFHPNVDVYGNICLDILQDKWSSAYDV 133          

HSP 2 Score: 28.8758 bits (63), Expect = 1.491e-12
Identity = 14/42 (33.33%), Postives = 21/42 (50.00%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            KR+  EL  L        SA P  +++F W+ TI G  D+ +
Sbjct:   38 KRLQSELMGLMMGGGPGISAFPEEDNIFCWKGTITGSKDTVF 79          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_RAT (Ubiquitin-conjugating enzyme E2 S OS=Rattus norvegicus GN=Ube2s PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.916e-12
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G+F + +    D+P  PPK  F TK+FHPN+  NG IC+++LK  W+  L I
Sbjct:   58 GLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGI 109          

HSP 2 Score: 36.5798 bits (83), Expect = 1.916e-12
Identity = 17/41 (41.46%), Postives = 21/41 (51.22%), Query Frame = 3
Query:  207 ILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            + KE+  L  DPP      P  ED+   Q TI GP  +PYA
Sbjct:   16 VYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYA 56          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_MOUSE (Ubiquitin-conjugating enzyme E2 S OS=Mus musculus GN=Ube2s PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.916e-12
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G+F + +    D+P  PPK  F TK+FHPN+  NG IC+++LK  W+  L I
Sbjct:   58 GLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGI 109          

HSP 2 Score: 36.5798 bits (83), Expect = 1.916e-12
Identity = 17/41 (41.46%), Postives = 21/41 (51.22%), Query Frame = 3
Query:  207 ILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            + KE+  L  DPP      P  ED+   Q TI GP  +PYA
Sbjct:   16 VYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYA 56          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2SA_XENLA (Ubiquitin-conjugating enzyme E2 S-A OS=Xenopus laevis GN=ube2s-A PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.916e-12
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G+F + +    D+P  PPK  F TK+FHPN+  NG IC+++LK  W+  L I
Sbjct:   58 GLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGI 109          

HSP 2 Score: 36.5798 bits (83), Expect = 1.916e-12
Identity = 17/41 (41.46%), Postives = 21/41 (51.22%), Query Frame = 3
Query:  207 ILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            + KE+  L  DPP      P  ED+   Q TI GP  +PYA
Sbjct:   16 VYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYA 56          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_XENTR (Ubiquitin-conjugating enzyme E2 S OS=Xenopus tropicalis GN=ube2s PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.921e-12
Identity = 23/52 (44.23%), Postives = 35/52 (67.31%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G+F + +    D+P  PPK  F TK+FHPN+++NG IC+++LK+ W   L I
Sbjct:   58 GIFRMKLILGKDFPAAPPKGYFLTKIFHPNVSTNGEICVNVLKKDWKAELGI 109          

HSP 2 Score: 35.039 bits (79), Expect = 1.921e-12
Identity = 16/43 (37.21%), Postives = 22/43 (51.16%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++ KE+  L  DPP      P  ED+   Q  I GP  +PYA
Sbjct:   14 RQVYKEVSTLTSDPPEGIKIIPNEEDITDVQVNIEGPEGTPYA 56          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2T_XENLA (Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevis GN=ube2t PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.930e-12
Identity = 31/60 (51.67%), Postives = 40/60 (66.67%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKMV 505
            G+F + I  P  YPF+PPK+ F T ++HPNI+S G ICLDIL    K  W PAL IS ++
Sbjct:   49 GIFNLEIIVPERYPFEPPKIRFLTPIYHPNIDSAGRICLDILKLPPKGAWRPALNISTVL 108          

HSP 2 Score: 28.4906 bits (62), Expect = 1.930e-12
Identity = 15/41 (36.59%), Postives = 22/41 (53.66%), Query Frame = 3
Query:  204 RILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            R+ +EL+ L K+PP          +M   +A I+G S SPY
Sbjct:    6 RLKRELQLLNKEPPPGVICWQNESNMDDLRAQIIGGSGSPY 46          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBE2S_BOVIN1.136e-1244.23Ubiquitin-conjugating enzyme E2 S OS=Bos taurus GN... [more]
UBE2S_DROAN1.139e-1245.61Ubiquitin-conjugating enzyme E2 S OS=Drosophila an... [more]
UB2SB_XENLA1.139e-1244.23Ubiquitin-conjugating enzyme E2 S-B OS=Xenopus lae... [more]
UBE2S_DROWI1.480e-1246.43Ubiquitin-conjugating enzyme E2 S OS=Drosophila wi... [more]
UBC20_ARATH1.491e-1252.00Ubiquitin carrier protein E2 20 OS=Arabidopsis tha... [more]
UBE2S_RAT1.916e-1244.23Ubiquitin-conjugating enzyme E2 S OS=Rattus norveg... [more]
UBE2S_MOUSE1.916e-1244.23Ubiquitin-conjugating enzyme E2 S OS=Mus musculus ... [more]
UB2SA_XENLA1.916e-1244.23Ubiquitin-conjugating enzyme E2 S-A OS=Xenopus lae... [more]
UBE2S_XENTR1.921e-1244.23Ubiquitin-conjugating enzyme E2 S OS=Xenopus tropi... [more]
UBE2T_XENLA1.930e-1251.67Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top