EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2G1_MOUSE (Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 59.6918 bits (143), Expect = 9.323e-12
Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKE 469
            GVF   + FP DYP +PPK+ F T+++HPN++ NG +C+ IL E
Sbjct:   53 GVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHE 96          

HSP 2 Score: 31.5722 bits (70), Expect = 9.323e-12
Identity = 14/39 (35.90%), Postives = 24/39 (61.54%), Query Frame = 3
Query:  213 KELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            ++L +L K+P    SAG   + D++ W+  I+GP D+ Y
Sbjct:   12 RQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLY 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2G1_MACFA (Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 9.323e-12
Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKE 469
            GVF   + FP DYP +PPK+ F T+++HPN++ NG +C+ IL E
Sbjct:   53 GVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHE 96          

HSP 2 Score: 31.5722 bits (70), Expect = 9.323e-12
Identity = 14/39 (35.90%), Postives = 24/39 (61.54%), Query Frame = 3
Query:  213 KELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            ++L +L K+P    SAG   + D++ W+  I+GP D+ Y
Sbjct:   12 RQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLY 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2G1_HUMAN (Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3)

HSP 1 Score: 59.6918 bits (143), Expect = 9.323e-12
Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKE 469
            GVF   + FP DYP +PPK+ F T+++HPN++ NG +C+ IL E
Sbjct:   53 GVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHE 96          

HSP 2 Score: 31.5722 bits (70), Expect = 9.323e-12
Identity = 14/39 (35.90%), Postives = 24/39 (61.54%), Query Frame = 3
Query:  213 KELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            ++L +L K+P    SAG   + D++ W+  I+GP D+ Y
Sbjct:   12 RQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLY 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2N_RAT (Ubiquitin-conjugating enzyme E2 N OS=Rattus norvegicus GN=Ube2n PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.294e-11
Identity = 42/95 (44.21%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  278 HVPLASHNYGPF**PIC*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVKL*TNARYSA--DDDWLLN 556
            HV +A     PF        G F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I + V L   A  SA   DD L N
Sbjct:   36 HVVIAGPQDSPF------EGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQI-RTVLLSIQALLSAPNPDDPLAN 123          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2N_PONAB (Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii GN=UBE2N PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.294e-11
Identity = 42/95 (44.21%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  278 HVPLASHNYGPF**PIC*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVKL*TNARYSA--DDDWLLN 556
            HV +A     PF        G F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I + V L   A  SA   DD L N
Sbjct:   36 HVVIAGPQDSPF------EGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQI-RTVLLSIQALLSAPNPDDPLAN 123          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2N_MOUSE (Ubiquitin-conjugating enzyme E2 N OS=Mus musculus GN=Ube2n PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.294e-11
Identity = 42/95 (44.21%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  278 HVPLASHNYGPF**PIC*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVKL*TNARYSA--DDDWLLN 556
            HV +A     PF        G F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I + V L   A  SA   DD L N
Sbjct:   36 HVVIAGPQDSPF------EGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQI-RTVLLSIQALLSAPNPDDPLAN 123          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2N_HUMAN (Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens GN=UBE2N PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.294e-11
Identity = 42/95 (44.21%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  278 HVPLASHNYGPF**PIC*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVKL*TNARYSA--DDDWLLN 556
            HV +A     PF        G F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I + V L   A  SA   DD L N
Sbjct:   36 HVVIAGPQDSPF------EGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQI-RTVLLSIQALLSAPNPDDPLAN 123          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2N_BOVIN (Ubiquitin-conjugating enzyme E2 N OS=Bos taurus GN=UBE2N PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.294e-11
Identity = 42/95 (44.21%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  278 HVPLASHNYGPF**PIC*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVKL*TNARYSA--DDDWLLN 556
            HV +A     PF        G F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I + V L   A  SA   DD L N
Sbjct:   36 HVVIAGPQDSPF------EGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQI-RTVLLSIQALLSAPNPDDPLAN 123          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_BRAFL (Ubiquitin-conjugating enzyme E2 S OS=Branchiostoma floridae GN=BRAFLDRAFT_259979 PE=3 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.552e-11
Identity = 22/56 (39.29%), Postives = 34/56 (60.71%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + ++   D+P  PPK  F TK+FHPN+  NG IC++ LK+ W   L +  ++
Sbjct:   60 GQFKIKLSLGKDFPQTPPKGFFLTKIFHPNVAKNGEICVNTLKKDWKADLGLKHIL 115          

HSP 2 Score: 35.8094 bits (81), Expect = 1.552e-11
Identity = 16/42 (38.10%), Postives = 23/42 (54.76%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            +++ KE+ DL   PP      P  +D+   QATI GP  +PY
Sbjct:   16 RQVAKEVLDLANHPPEGVKVFPNEQDITDVQATIEGPGGTPY 57          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2C_MACFA (Ubiquitin-conjugating enzyme E2 C OS=Macaca fascicularis GN=UBE2C PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.567e-11
Identity = 21/45 (46.67%), Postives = 33/45 (73.33%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWS 478
            + +++ FP  YP+  P V F T  +HPN+++ G+ICLDILK++WS
Sbjct:   79 YKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWS 123          

HSP 2 Score: 32.7278 bits (73), Expect = 1.567e-11
Identity = 15/46 (32.61%), Postives = 25/46 (54.35%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYADMQ 338
            KR+ +EL  L        SA P ++++F W  TI G + + Y D++
Sbjct:   33 KRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLR 78          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UB2G1_MOUSE9.323e-1250.00Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus... [more]
UB2G1_MACFA9.323e-1250.00Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fasci... [more]
UB2G1_HUMAN9.323e-1250.00Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens... [more]
UBE2N_RAT1.294e-1144.21Ubiquitin-conjugating enzyme E2 N OS=Rattus norveg... [more]
UBE2N_PONAB1.294e-1144.21Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii ... [more]
UBE2N_MOUSE1.294e-1144.21Ubiquitin-conjugating enzyme E2 N OS=Mus musculus ... [more]
UBE2N_HUMAN1.294e-1144.21Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens ... [more]
UBE2N_BOVIN1.294e-1144.21Ubiquitin-conjugating enzyme E2 N OS=Bos taurus GN... [more]
UBE2S_BRAFL1.552e-1139.29Ubiquitin-conjugating enzyme E2 S OS=Branchiostoma... [more]
UBE2C_MACFA1.567e-1146.67Ubiquitin-conjugating enzyme E2 C OS=Macaca fascic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top