EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2G2_HUMAN (Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens GN=UBE2G2 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 2.958e-14
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 2
Query:  326 C*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKMV 505
            C   GVF   ++FP DYP  PPK+ F  ++FHPNI  +G +C+ IL              E+WSP  ++ K++
Sbjct:   48 CFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL 120          

HSP 2 Score: 41.5874 bits (96), Expect = 2.958e-14
Identity = 20/43 (46.51%), Postives = 26/43 (60.47%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPA-AEDMFHWQATIMGPSDS 320
            A KR++ E K L  +PP    AGP   E+ F W+A IMGP D+
Sbjct:    5 ALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDT 47          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2G2_BOVIN (Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 2.958e-14
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 2
Query:  326 C*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKMV 505
            C   GVF   ++FP DYP  PPK+ F  ++FHPNI  +G +C+ IL              E+WSP  ++ K++
Sbjct:   48 CFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL 120          

HSP 2 Score: 41.5874 bits (96), Expect = 2.958e-14
Identity = 20/43 (46.51%), Postives = 26/43 (60.47%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPA-AEDMFHWQATIMGPSDS 320
            A KR++ E K L  +PP    AGP   E+ F W+A IMGP D+
Sbjct:    5 ALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDT 47          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2L6_HUMAN (Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Homo sapiens GN=UBE2L6 PE=1 SV=4)

HSP 1 Score: 66.6254 bits (161), Expect = 2.974e-14
Identity = 26/47 (55.32%), Postives = 35/47 (74.47%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-KEQWSP 481
            F + I+FPP+YPFKPP + F TK++HPN++ NG ICL I+  E W P
Sbjct:   51 FNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKP 97          

HSP 2 Score: 33.113 bits (74), Expect = 2.974e-14
Identity = 20/49 (40.82%), Postives = 30/49 (61.22%), Query Frame = 3
Query:  189 VMASKRILKELKDLQKDPP---TSCSAGPAAEDMFHWQATIMGPSDSPY 326
            +MAS R++KEL+DLQK PP    + S+  A  ++  W A ++ P   PY
Sbjct:    1 MMASMRVVKELEDLQKKPPPYLRNLSSDDA--NVLVWHALLL-PDQPPY 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC11_YEAST (Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae GN=UBC11 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.858e-14
Identity = 26/59 (44.07%), Postives = 43/59 (72.88%), Query Frame = 2
Query:  332 YAGV-FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            Y+G+ F V++ FP +YPF PP + F + ++HPN++ +G+ICLDILKE+WS    +  ++
Sbjct:   53 YSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETIL 111          

HSP 2 Score: 33.4982 bits (75), Expect = 3.858e-14
Identity = 17/48 (35.42%), Postives = 26/48 (54.17%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPYADMQ 338
            +KR+  EL  L      S SA P  + D+ +W   I GP D+PY+ ++
Sbjct:   10 TKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLK 57          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROGR (Ubiquitin-conjugating enzyme E2 S OS=Drosophila grimshawi GN=GH12079 PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.406e-13
Identity = 26/56 (46.43%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G+F V +    D+P  PPK  F TK+FHPN+ SNG IC++ LK+ W P L I  ++
Sbjct:   61 GIFRVKLTLSKDFPQTPPKAYFLTKIFHPNVASNGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 33.8834 bits (76), Expect = 1.406e-13
Identity = 15/43 (34.88%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            ++++KEL+D++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMKELQDMESTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC7_SCHPO (Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe GN=ubc3 PE=2 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 1.423e-13
Identity = 22/69 (31.88%), Postives = 37/69 (53.62%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKMV 505
            G++   + FP DYP  PP + F  + FHPN+  +G++C+ IL              E+WSP  ++ K++
Sbjct:   53 GLYPATLKFPSDYPLGPPTLKFECEFFHPNVYKDGTVCISILHAPGDDPNMYESSSERWSPVQSVEKIL 121          

HSP 2 Score: 43.5134 bits (101), Expect = 1.423e-13
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 3
Query:  186 RVMASKRILKELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            + MA +R++KE K+L ++ P   +AGP+ E D F W   I GP  +P+
Sbjct:    3 KAMALRRLMKEYKELTENGPDGITAGPSNEDDFFTWDCLIQGPDGTPF 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROVI (Ubiquitin-conjugating enzyme E2 S OS=Drosophila virilis GN=GJ15767 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.826e-13
Identity = 27/56 (48.21%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF V +    D+P  PPK  F TK+FHPN+ SNG IC++ LK+ W P L I  ++
Sbjct:   61 GVFRVKLTLSKDFPQTPPKAYFLTKIFHPNVASNGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 33.113 bits (74), Expect = 1.826e-13
Identity = 15/43 (34.88%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            ++++KEL+D++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMKELQDMETTPPEGIKVLINESDVTDIQAFIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC27_ARATH (Ubiquitin carrier protein E2 27 OS=Arabidopsis thaliana GN=UBC27 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.359e-13
Identity = 34/53 (64.15%), Postives = 43/53 (81.13%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTI 493
            G F + I  P  YPF+PPK+ F TKV+HPNI+S +G+ICLDILK+QWSPALT+
Sbjct:   50 GTFQIDITMPDGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTL 102          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC11_SCHPO (Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosaccharomyces pombe GN=ubc11 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.392e-13
Identity = 23/59 (38.98%), Postives = 43/59 (72.88%), Query Frame = 2
Query:  332 YAGV-FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            Y G+ F ++++FP +YP+ PP + F + ++HPN++ +G+ICLDILK++WS    +  ++
Sbjct:   73 YEGLKFKISMSFPANYPYSPPTIIFTSPMWHPNVDMSGNICLDILKDKWSAVYNVQTIL 131          

HSP 2 Score: 33.8834 bits (76), Expect = 2.392e-13
Identity = 17/48 (35.42%), Postives = 26/48 (54.17%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPYADMQ 338
            +KR+  EL  L        SA P ++ ++ HW  TI GPSD+ Y  ++
Sbjct:   30 TKRLRSELMSLMMSNTPGISAFPDSDSNLLHWAGTITGPSDTYYEGLK 77          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2SC_XENLA (Ubiquitin-conjugating enzyme E2 S-C OS=Xenopus laevis GN=ube2s-C PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.001e-13
Identity = 24/53 (45.28%), Postives = 36/53 (67.92%), Query Frame = 2
Query:  335 AGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            AG+F + +    D+P  PPK  F TK+FHPN+++NG IC+++LK+ W   L I
Sbjct:   57 AGIFRMKLILGKDFPAAPPKGYFLTKIFHPNVSNNGEICVNVLKKDWKAELGI 109          

HSP 2 Score: 35.8094 bits (81), Expect = 4.001e-13
Identity = 17/43 (39.53%), Postives = 22/43 (51.16%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +R+ KE+  L  DPP      P  ED+   Q  I GP  +PYA
Sbjct:   14 RRVYKEVSTLTSDPPEGIKIIPNEEDITDVQVHIEGPEGTPYA 56          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UB2G2_HUMAN2.958e-1436.99Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens... [more]
UB2G2_BOVIN2.958e-1436.99Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus G... [more]
UB2L6_HUMAN2.974e-1455.32Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Homo s... [more]
UBC11_YEAST3.858e-1444.07Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharo... [more]
UBE2S_DROGR1.406e-1346.43Ubiquitin-conjugating enzyme E2 S OS=Drosophila gr... [more]
UBC7_SCHPO1.423e-1331.88Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosa... [more]
UBE2S_DROVI1.826e-1348.21Ubiquitin-conjugating enzyme E2 S OS=Drosophila vi... [more]
UBC27_ARATH2.359e-1364.15Ubiquitin carrier protein E2 27 OS=Arabidopsis tha... [more]
UBC11_SCHPO2.392e-1338.98Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosa... [more]
UB2SC_XENLA4.001e-1345.28Ubiquitin-conjugating enzyme E2 S-C OS=Xenopus lae... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top