EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP_ANOGA (Aquaporin AQPAn.G OS=Anopheles gambiae GN=AGAP008842 PE=3 SV=4)

HSP 1 Score: 83.5741 bits (205), Expect = 1.649e-15
Identity = 66/205 (32.20%), Postives = 98/205 (47.80%), Query Frame = 1
Query:  229 LMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF-QEKQDQFA*TLXAG--SNIQAFVMEFIITFYLMFVISGVATDNRA-IGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            L+AE LGT+F++  G  S     +     +L  I+  +GLVV  L  + GH+SG H NP+VTI           +   YI+ Q +G+   A  ++     E       T  A   S  Q  ++E +ITF L+FV+ GV  + R  +   A LA+G ++ A  + A   TGASMN   S G +    +   LW+Y V  + G   A
Sbjct:   26 LVAEFLGTFFLVAIGIGSTTGWTDYSP--TLTQIAFTFGLVVATLAQAFGHVSGCHINPAVTIGLIVTADVSILKGAFYIVSQCIGAIAGAAVIKAATPSEVVGGLGVTGIAPGLSTGQGVLIEALITFMLVFVVHGVCDNRRTDVKGSAPLAIGLSITAGHLAAIKYTGASMNPARSFGPAVVMGNYTDLWVYWVGPIVGGIVA 228          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP8_NOTAL (Aquaporin-8 OS=Notomys alexis GN=AQP8 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.154e-15
Identity = 49/180 (27.22%), Postives = 94/180 (52.22%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQ------DQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMN 738
            ++Q  + E+LG+   IF GC SV+ N  +  ++     ++  GL + +++ +LG+ISG HFNP+V++A           + PY + Q+ G  + A   +++  E++        FA         +A  +E I+T  L+  +   A + + +G LA  ++GF+V+ +++    I+GA MN
Sbjct:   34 YIQPCVVELLGSALFIFIGCLSVIENSPDTGLLQP---ALAHGLALGLIIATLGNISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQIFGGLIGAALAKVVSPEERFWNASGAAFAIVQEQEQVTEALGVEIILTILLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMN 210          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP2_TOBAC (Probable aquaporin TIP-type RB7-18C OS=Nicotiana tabacum PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 2.814e-15
Identity = 66/222 (29.73%), Postives = 103/222 (46.40%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPG---ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVGYKWG 846
            FSV  ++  +AE + T   +FAG  S +    L  +  +   G   +++     + V V    +ISG H NP+VT+  A            Y + Q+LGST+A   L+ +               +  Q  VME IITF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  +      WIY    L G   A G+ +G
Sbjct:   13 FSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITILTGFFYWIAQLLGSTVACLLLKYVTNGLAVPTHGVAAGLNGFQGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWAGPLIGGGLA-GFIYG 233          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP22_ARATH (Probable aquaporin TIP2-2 OS=Arabidopsis thaliana GN=TIP2-2 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 2.814e-15
Identity = 62/216 (28.70%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPG---ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            FSV  ++  ++E + T   +FAG  S +    L ++  +   G   +++     + V V    +ISG H NP+VT+  A            Y + Q LGS +A   L  +   +             I+  VME ++TF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  S     +WIY V  L G   A
Sbjct:   13 FSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVACLLLVFVTNGESVPTHGVAAGLGAIEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALA 228          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP8_RAT (Aquaporin-8 OS=Rattus norvegicus GN=Aqp8 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.814e-15
Identity = 49/180 (27.22%), Postives = 94/180 (52.22%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQ------DQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMN 738
            ++Q  + E+LG+   IF GC SV+ N  N  ++     ++  GL + +++ +LG+ISG HFNP+V++A           + PY + Q+ G  + A   +++  E++        FA         +A  +E ++T  L+  +   A + + +G LA  ++GF+V+ +++    I+GA MN
Sbjct:   36 YIQPCVVELLGSALFIFIGCLSVIENSPNTGLLQP---ALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMN 212          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP4_HUMAN (Aquaporin-4 OS=Homo sapiens GN=AQP4 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 2.814e-15
Identity = 68/214 (31.78%), Postives = 97/214 (45.33%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKI--VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQA---FVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVG 834
            F + + AE L     +     S +     EK   V +  IS+ +GL +  +V   GHISG H NP+VT+A    ++    +   YI  Q LG+ + AG L L+                N+ A    ++E IITF L+F I       R    G +A LA+GF+V    +FA   TGASMN   S G +    + +  WIY V  + G   A G
Sbjct:   34 FWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIA-LAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGG 246          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP4_DIPME (Aquaporin-4 OS=Dipodomys merriami GN=AQP4 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.675e-15
Identity = 67/214 (31.31%), Postives = 96/214 (44.86%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQA---FVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVG 834
            F + + AE L     +     S +      N   V +  IS+ +GL +  +V   GHISG H NP+VT+A    ++    +   YI  Q LG+ + AG L L+                N+ A    ++E IITF L+F I       R    G +A LA+GF+V    +FA   TGASMN   S G +    + +  WIY V  + G   A G
Sbjct:   34 FWKAVTAEFLAMLIFVLLSLGSTINWGGKENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIA-LAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGG 246          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP23_MAIZE (Aquaporin TIP2-3 OS=Zea mays GN=TIP2-3 PE=2 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 4.799e-15
Identity = 63/211 (29.86%), Postives = 99/211 (46.92%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEK-----IVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            S   ++  +AE + T   +FAG  S +      K        L  I+I     + V V    +ISG H NP+VT   A            Y + Q+LG+++A   L+ +    Q      +   S I+  VME +ITF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  + +  G W+Y V  L G
Sbjct:   14 SAASLKAYVAEFIATLLFVFAGVGSAIAYSQLTKGGALDPAGLVAIAIAHAFALFVGVSMAANISGGHLNPAVTFGLAVGGHITILTGILYWVAQLLGASVACFLLQYV-THGQAIPTHGVSGISEIEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPMAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAGNFAGNWVYWVGPLVG 223          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP1_MEDTR (Probable aquaporin TIP-type OS=Medicago truncatula GN=AQP1 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.799e-15
Identity = 63/203 (31.03%), Postives = 95/203 (46.80%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVV--NLNNEKIVSLPGI---SIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRA--IGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            +AE + T+  +FAG  S +    L N+   +  G+   SI     + V V    +ISG H NP+VT            +   YI+ Q+LGS +A+  L  +       F  +   G    A V+E ++TF L++ +   A D +   IG +A +A+GF V AN++     TGASMN   S G +  S S    W+Y    L G
Sbjct:   24 LAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSIVASALLVFVTASSVPAFGLSEGVGVG-PALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIG 225          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP_AEDAE (Aquaporin AQPAe.a OS=Aedes aegypti GN=AAEL003512 PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 6.268e-15
Identity = 64/208 (30.77%), Postives = 98/208 (47.12%), Query Frame = 1
Query:  229 LMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEK------QDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRA-IGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            L+AE LGT+F++  G  S +     +   ++  I+  +GLVV  L  + GH+SG H NP+VTI           +   YI+ Q +G+   A  ++                   L AG   Q  ++E +ITF L+FV+ GV  + R+ I   A LA+G ++ A  + A   TGASMN   S G +    +    W+Y V  + G   A
Sbjct:   26 LVAEFLGTFFLVSIGIGSTM-GWGGDYAPTMTQIAFTFGLVVATLAQAFGHVSGCHINPAVTIGLMITADISILKGAFYIVSQCVGAIAGAALIKAATPSDVIGGLGVTGIDPRLTAG---QGVMIEALITFILVFVVHGVCDNRRSDIKGSAPLAIGLSITAGHLSAIKYTGASMNPARSFGPAVVMGNWTDQWVYWVGPIVGGILA 229          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
AQP_ANOGA1.649e-1532.20Aquaporin AQPAn.G OS=Anopheles gambiae GN=AGAP0088... [more]
AQP8_NOTAL2.154e-1527.22Aquaporin-8 OS=Notomys alexis GN=AQP8 PE=2 SV=1[more]
TIP2_TOBAC2.814e-1529.73Probable aquaporin TIP-type RB7-18C OS=Nicotiana t... [more]
TIP22_ARATH2.814e-1528.70Probable aquaporin TIP2-2 OS=Arabidopsis thaliana ... [more]
AQP8_RAT2.814e-1527.22Aquaporin-8 OS=Rattus norvegicus GN=Aqp8 PE=2 SV=1[more]
AQP4_HUMAN2.814e-1531.78Aquaporin-4 OS=Homo sapiens GN=AQP4 PE=1 SV=2[more]
AQP4_DIPME3.675e-1531.31Aquaporin-4 OS=Dipodomys merriami GN=AQP4 PE=2 SV=... [more]
TIP23_MAIZE4.799e-1529.86Aquaporin TIP2-3 OS=Zea mays GN=TIP2-3 PE=2 SV=2[more]
TIP1_MEDTR4.799e-1531.03Probable aquaporin TIP-type OS=Medicago truncatula... [more]
AQP_AEDAE6.268e-1530.77Aquaporin AQPAe.a OS=Aedes aegypti GN=AAEL003512 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top