EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP7_MACFA (Aquaporin-7 OS=Macaca fascicularis GN=AQP7 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.186e-15
Identity = 42/101 (41.58%), Postives = 62/101 (61.39%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF 522
            +++ +AE + TY M+  G  SV   + N+K  S  G+++ +G  V + V+  GHISGAH N +VT A+    R PW++ P Y+L Q LGS LAA T+  LF
Sbjct:   34 VREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGVNLGFGFGVTMGVHVAGHISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYTLF 134          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP4_NOTAL (Aquaporin-4 OS=Notomys alexis GN=AQP4 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.186e-15
Identity = 65/208 (31.25%), Postives = 94/208 (45.19%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQA---FVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            F + + AE L     +     S +      N   V +  IS+ +GL +  +V   GHISG H NP+VT+A    ++    +   YI  Q LG+ + AG L L+                N+ A    ++E IITF L+F I       R    G +A LA+GF+V    +FA   TGASMN   S G +    + +  WIY V  + G
Sbjct:   37 FWKAVTAEFLAMLIFVLLSVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYITAQCLGAIIGAGILYLVTPPNVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIA-LAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG 243          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP4_BOVIN (Aquaporin-4 OS=Bos taurus GN=AQP4 PE=2 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 8.186e-15
Identity = 68/214 (31.78%), Postives = 96/214 (44.86%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKI--VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQA---FVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVG 834
            F + + AE L     +     S +     EK   V +  IS+ +GL +  +V   GHISG H NP+VT+A    +R    +   YI  Q LG+ + AG L L+                N+ A    ++E IITF L+F I       R    G +A LA+G +V    +FA   TGASMN   S G +    + +  WIY V  + G   A G
Sbjct:   34 FWKAVTAEFLAMLIFVLLSLGSTINWGGAEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRRISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLSAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIA-LAIGISVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGG 246          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP4_RAT (Aquaporin-4 OS=Rattus norvegicus GN=Aqp4 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.069e-14
Identity = 63/207 (30.43%), Postives = 92/207 (44.44%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQA---FVMEFIITFYLMFVISGVATDNRA-IGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            F + + AE L     +     S +      N   V +  IS+ +GL +  +V   GHISG H NP+VT+A    ++    +   YI  Q LG+ + AG L L+                N+ A    ++E IITF L+F I       R  +     LA+GF+V    +FA   TGASMN   S G +    + +  WIY V  + G
Sbjct:   34 FWKAVTAEFLAMLIFVLLSVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYITAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG 240          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP32_ARATH (Probable aquaporin TIP3-2 OS=Arabidopsis thaliana GN=TIP3-2 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.306e-14
Identity = 63/212 (29.72%), Postives = 99/212 (46.70%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVV-VNLNNEKIVSLPGISIVWGLVVMVLVYSLG---------HISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            +AE L T+  +FAG  S++ ++       +  G +   GLV++ L ++L          ++SG H NP+VT A     R    +   Y + Q++G+ LA   LRL     +          S +   +ME I+TF L++V+   A D +  +IG +A LA+G  V AN++   P  GASMN   + G +         WIY V    G   A
Sbjct:   27 LAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGLVLVALAHALALFAAVSAAINVSGGHVNPAVTFAALIGGRISVIRAIYYWVAQLIGAILACLLLRLATNGLRPVGFHVASGVSELHGLLMEIILTFALVYVVYSTAIDPKRGSIGIIAPLAIGLIVGANILVGGPFDGASMNPARAFGPALVGWRWSNHWIYWVGPFIGGALA 238          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: MIP_RANPI (Lens fiber major intrinsic protein OS=Rana pipiens PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.306e-14
Identity = 67/210 (31.90%), Postives = 103/210 (49.05%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVAT-DNRAIGEL--AGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            S  F + + AE  GT F +F G  + +        V +  I++ +GLV+  +V S+GH+SGAH NP+VT A     +    +   YI  Q+LG+   A  L  +     + +    TL  G ++ QA  +E  +T  L FV+   AT D R  G L    LA+GF++    +F    TGASMN   S A +  +++    W+Y V  + G
Sbjct:    6 SFSFWRAVFAEFFGTMFYVFFGLGASLKWAAGPANVLV--IALAFGLVLATMVQSIGHVSGAHINPAVTFAFLIGSQMSLFRAIFYIAAQLLGAVAGAAVLYGVTPAAIRGNLALNTLHPGVSLGQATTVEIFLT--LQFVLCIFATYDERRNGRLGSVSLAIGFSLTLGHLFGLYYTGASMNPARSFAPAVLTRNFTNHWVYWVGPIIG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP22_ORYSJ (Probable aquaporin TIP2-2 OS=Oryza sativa subsp. japonica GN=TIP2-2 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.930e-14
Identity = 60/212 (28.30%), Postives = 95/212 (44.81%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNE-----KIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            FS   ++  +AE + T   +FAG  S +               L  +++  G  + V V    +ISG H NP+VT   A   +        Y + Q+LG+ + A  ++             L      +  VME I+TF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  S     +WIY V  L G
Sbjct:   14 FSAASLKAYVAEFISTLVFVFAGVGSAIAYTKLTGGAPLDPAGLVAVAVCHGFGLFVAVAIGANISGGHVNPAVTFGLALGGQITILTGVFYWIAQLLGAIVGAVLVQFCTGVATPTHG--LSGVGAFEGVVMEIIVTFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGANILVAGPFSGGSMNPARSFGPAVASGDYTNIWIYWVGPLVG 223          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: GLPF_HAEIN (Glycerol uptake facilitator protein OS=Haemophilus influenzae GN=glpF PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.930e-14
Identity = 61/192 (31.77%), Postives = 89/192 (46.35%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE------------KQDQFA*TLXAGSNIQ---------AFVMEFIITFYLMFVISGVATDNRAI--GELAGLAVGFTVLANVMFARPITGASMN 738
            + E LGT  +IF G   V           L  ISI+WG+ V + VY+   +SGAH NP+VTIA      F  K+V PYI+ Q+LG+  AA  +  L++             +  Q + +L    +           AF +EF+IT  LM +I  +  D   +  G LA L +G  +        P+TG +MN
Sbjct:   10 IGEFLGTALLIFFGVGCVAALKVAGASFGLWEISIMWGMGVALAVYATAGLSGAHLNPAVTIALWKFACFDGKKVIPYIISQMLGAFFAAALVYALYRNVFIDYETVHNIVRGTQESLSLAGTFSTYPHPSLSIGGAFAVEFVITAILMALIMALTDDGNGVPRGPLAPLLIGILIAVIGGAMGPLTGFAMN 201          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: GLPF_PSEAE (Glycerol uptake facilitator protein OS=Pseudomonas aeruginosa GN=glpF PE=3 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 9.051e-14
Identity = 61/192 (31.77%), Postives = 87/192 (45.31%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQF--A*TLXAGSNI-------------------QAFVMEFIITFYLMFVISGVATDNRAI--GELAGLAVGFTVLANVMFARPITGASMN 738
            +AE LGT  +IF G   V           L  ISI+WG+ V + +Y    +SGAH NP+V+IA      F  +++P YI  QV G+  AA  +  L+     +F  A  +  GS                     QAF++E +IT  LM VI  +  D   +  G LA L +G  +        P+TG +MN
Sbjct:   15 LAEFLGTALLIFFGTGCVAALKVAGASFGLWEISIIWGVGVSMAIYLSAGVSGAHLNPAVSIALWLFAGFEGRKLPFYITAQVAGAFCAAALVYTLYSSLFIEFEQAQNIVRGSQDSLALASVFSTYPHPALSVGQAFLVEVVITAILMAVIMALTDDGNGLPRGPLAPLLIGLLIAVIGSAMGPLTGFAMN 206          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP7_HUMAN (Aquaporin-7 OS=Homo sapiens GN=AQP7 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.051e-14
Identity = 41/101 (40.59%), Postives = 61/101 (60.40%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF 522
            +++ +AE + TY M+  G  SV   + N+K  S  G+++ +G  V + V+  G ISGAH N +VT A+    R PW++ P Y+L Q LGS LAA T+  LF
Sbjct:   34 VREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLF 134          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
AQP7_MACFA8.186e-1541.58Aquaporin-7 OS=Macaca fascicularis GN=AQP7 PE=2 SV... [more]
AQP4_NOTAL8.186e-1531.25Aquaporin-4 OS=Notomys alexis GN=AQP4 PE=2 SV=1[more]
AQP4_BOVIN8.186e-1531.78Aquaporin-4 OS=Bos taurus GN=AQP4 PE=2 SV=3[more]
AQP4_RAT1.069e-1430.43Aquaporin-4 OS=Rattus norvegicus GN=Aqp4 PE=1 SV=1[more]
TIP32_ARATH5.306e-1429.72Probable aquaporin TIP3-2 OS=Arabidopsis thaliana ... [more]
MIP_RANPI5.306e-1431.90Lens fiber major intrinsic protein OS=Rana pipiens... [more]
TIP22_ORYSJ6.930e-1428.30Probable aquaporin TIP2-2 OS=Oryza sativa subsp. j... [more]
GLPF_HAEIN6.930e-1431.77Glycerol uptake facilitator protein OS=Haemophilus... [more]
GLPF_PSEAE9.051e-1431.77Glycerol uptake facilitator protein OS=Pseudomonas... [more]
AQP7_HUMAN9.051e-1440.59Aquaporin-7 OS=Homo sapiens GN=AQP7 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top