EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: MIP_RAT (Lens fiber major intrinsic protein (Fragment) OS=Rattus norvegicus GN=Mip PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 1.544e-13
Identity = 67/216 (31.02%), Postives = 101/216 (46.76%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVAT-DNRAIGEL--AGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            S  F + + AE   T F +F G  S         +   PG      +++ +GL +  LV ++GHISGAH NP+VT A     +    +   YI  Q+LG+   A  L  +     + +    TL AG ++ QA  +E  +T  L FV+   AT D R  G +    LAVGF++    +F    TGA MN   S A +  +++    W+Y V  + G
Sbjct:    4 SASFWRAIFAEFFATLFYVFFGLGS--------SLRWAPGPLHVLQVALAFGLALATLVQTVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHAGVSVGQATTVEIFLT--LQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFSNHWVYWVGPIIG 209          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: GLPF_THEMA (Probable glycerol uptake facilitator protein OS=Thermotoga maritima GN=glpF PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.544e-13
Identity = 60/186 (32.26%), Postives = 89/186 (47.85%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAG---CASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF------QEKQDQFA*TLXAGSNIQAF----VMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMN 738
            M   +AE LGT  +I  G    A+VV+  +         I+  WGL V + VY +G ISGAH NP+VTI  A   +FPW +VP YI  Q+LG+ + A  + L +       +  D        G  ++ +    + E I T  L+  + G+  +  A G L  L VGF V +  +     TG ++N
Sbjct:    1 MSVYLAEFLGTMLLIILGDGVVANVVLKKSKGHNSGWIVITTGWGLAVAMSVYLVGRISGAHINPAVTIGLAFIGQFPWSKVPGYIFSQILGAFVGAILVYLTYLPHWKETDDPDAKLAVFCTGPAVRKYGANLLTEIIGTMVLLMGVLGIGANKLADG-LNPLLVGFLVWSIGLSLGGPTGYAIN 185          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP41_ARATH (Aquaporin TIP4-1 OS=Arabidopsis thaliana GN=TIP4-1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.016e-13
Identity = 65/206 (31.55%), Postives = 97/206 (47.09%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG-SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAG---LAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            ++ L+ E + T+  +FAG  S +   +L    +V L  +++    VV V++ S GHISG H NP+VT+           +   Y + Q+L S+ A   L  L          TL +G S  Q  + E I+TF L+F +     D +  G L G   L  GF V AN++     +GASMN   S G +  S +    W+Y V  L G
Sbjct:   18 IKALIVEFITTFLFVFAGVGSAMATDSLVGNTLVGLFAVAVAHAFVVAVMI-SAGHISGGHLNPAVTLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGMGTPVH-TLASGVSYTQGIIWEIILTFSLLFTVYATIVDPKK-GSLDGFGPLLTGFVVGANILAGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIG 220          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: MIP_SHEEP (Lens fiber major intrinsic protein OS=Ovis aries GN=MIP PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.439e-13
Identity = 65/216 (30.09%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVAT-DNRAIGEL--AGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            S  F + + AE   T F +F G  +         +   PG      +++ +GL +  LV ++GHISGAH NP+VT A     +    +   Y++ Q+LG+   A  L  +     + +    TL  G ++ QA ++E  +T  L FV+   AT D R  G L    LAVGF++    +F    TGA MN   S A +  +++    W+Y V  + G
Sbjct:    6 SASFWRAIFAEFFATLFYVFFGLGA--------SLRWAPGPLHVLQVALAFGLALATLVQAVGHISGAHVNPAVTFAFLVGSQMSLLRAICYVVAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPGVSVGQATIVEIFLT--LQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPVIG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: MIP_MOUSE (Lens fiber major intrinsic protein OS=Mus musculus GN=Mip PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 3.439e-13
Identity = 66/216 (30.56%), Postives = 101/216 (46.76%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVAT-DNRAIGEL--AGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            S  F + + AE   T F +F G  +         +   PG      +++ +GL +  LV ++GHISGAH NP+VT A     +    +   YI  Q+LG+   A  L  +     + +    TL AG ++ QA  +E  +T  L FV+   AT D R  G +    LAVGF++    +F    TGA MN   S A +  +++    W+Y V  + G
Sbjct:    6 SASFWRAIFAEFFATLFYVFFGLGA--------SLRWAPGPLHVLQVALAFGLALATLVQTVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHAGVSVGQATTVEIFLT--LQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFSNHWVYWVGPIIG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIPA_PHAVU (Probable aquaporin TIP-type alpha OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.492e-13
Identity = 60/211 (28.44%), Postives = 95/211 (45.02%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCAS--VVVNLNNEKIVS---LPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            M+  +AE   T+  +FAG  S   +V +  +   S   L  +++     +   V +  H+SG H NP+V+       R    +   Y + Q+LGS +AA  LRL+    +               F++E ++TF LM+ + G A D +  A+  +A LA+G  V AN++   P  GA MN   + G S         WI+ V  L G   A
Sbjct:   20 MRASLAEFASTFIFVFAGEGSGLALVKIYQDSAFSAGELLALALAHAFALFAAVSASMHVSGGHVNPAVSFGALIGGRISVIRAVYYWIAQLLGSIVAALVLRLVTNNMRPSGFHVSPGVGVGHMFILEVVMTFGLMYTVYGTAIDPKRGAVSYIAPLAIGLIVGANILVGGPFDGACMNPALAFGPSLVGWQWHQHWIFWVGPLLGAALA 230          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP1_MEDSA (Probable aquaporin TIP-type OS=Medicago sativa GN=MCP1 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 4.492e-13
Identity = 62/203 (30.54%), Postives = 95/203 (46.80%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVV--NLNNEKIVSLPGI---SIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRA--IGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            +AE + T+  +FAG  S +    L N+   +  G+   SI     + V V    +ISG H NP+V  A         + +  YI+ Q+LGS + +  L  +       F  +   G    A V+E ++TF L++ +   A D +   IG +A +A+GF V AN++     TGASMN   S G +  S S    W+Y    L G
Sbjct:   24 LAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAHAFALFVAVSVGANISGGHVNPAVFGAFVGGNITLLRGIV-YIIAQLLGSIVCSALLVFVTASSVPAFGLSEGVGVG-PALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIG 224          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: GLPF_BACSU (Glycerol uptake facilitator protein OS=Bacillus subtilis GN=glpF PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 4.492e-13
Identity = 62/187 (33.16%), Postives = 90/187 (48.13%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIV----WGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF---QEKQDQFA*TLXAGS-------NIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMN 738
            M     E++GT  +I  G A V   +N +K +S     IV    WGL V +  Y++G ISGAH NP++TIA A    FPWK+VP YI  Q++G+ + A  + L +    +  D  A  L   S            + E I TF L+  I  +  +    G L  L VGF ++A  +     TG ++N
Sbjct:    1 MTAFWGEVIGTMLLIIFG-AGVCAGVNLKKSLSFQSGWIVVVFGWGLGVAMAAYAVGGISGAHLNPALTIALAFVGDFPWKEVPVYIAAQMIGAIIGAVIIYLHYLPHWKSTDDPAAKLGVFSTGPSIPHTFANVLSEVIGTFVLVLGILAIGANQFTEG-LNPLIVGFLIVAIGISLGGTTGYAIN 185          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP41_ORYSJ (Probable aquaporin TIP4-1 OS=Oryza sativa subsp. japonica GN=TIP4-1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.867e-13
Identity = 64/208 (30.77%), Postives = 98/208 (47.12%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNE------KIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG-SNIQAFVMEFIITFYLMFVISGVATDNR-AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            ++ ++AE++ T+  +F G A+ +     E       + +L G++I   L   VLV +  H+SG H NP+VT+A          +   Y+  Q+L S+LA   LR L          TL +G   +Q  VME I+TF L+FV+     D R ++     L  G  V AN +     +GASMN   S G +  +      WIY +  L G
Sbjct:   19 VRAVLAELVLTFVFVFTGVAATMAAGVPEVAGAAMPMAALAGVAIATALAAGVLVTAGFHVSGGHLNPAVTVALLARGHITAFRSALYVAAQLLASSLACILLRYLTGGMATPVH-TLGSGIGPMQGLVMEIILTFSLLFVVYATILDPRSSVPGFGPLLTGLIVGANTIAGGNFSGASMNPARSFGPALATGVWTHHWIYWLGPLIG 225          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: GLPF_SHIFL (Glycerol uptake facilitator protein OS=Shigella flexneri GN=glpF PE=3 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 5.867e-13
Identity = 61/192 (31.77%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTL-----RLLFQEKQD-----------QFA*TLXAGSN-----IQAFVMEFIITFYLMFVISGVATDNRAI--GELAGLAVGFTVLANVMFARPITGASMN 738
            +AE LGT  +IF G   V              IS++WGL V + +Y    +SGAH NP+VTIA      F  ++V P+I+ QV G+  AA  +      L F  +Q              A T     N     +QAF +E +IT  LM +I  +  D   +  G LA L +G  +        P+TG +MN
Sbjct:   12 IAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMN 203          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
MIP_RAT1.544e-1331.02Lens fiber major intrinsic protein (Fragment) OS=R... [more]
GLPF_THEMA1.544e-1332.26Probable glycerol uptake facilitator protein OS=Th... [more]
TIP41_ARATH2.016e-1331.55Aquaporin TIP4-1 OS=Arabidopsis thaliana GN=TIP4-1... [more]
MIP_SHEEP3.439e-1330.09Lens fiber major intrinsic protein OS=Ovis aries G... [more]
MIP_MOUSE3.439e-1330.56Lens fiber major intrinsic protein OS=Mus musculus... [more]
TIPA_PHAVU4.492e-1328.44Probable aquaporin TIP-type alpha OS=Phaseolus vul... [more]
TIP1_MEDSA4.492e-1330.54Probable aquaporin TIP-type OS=Medicago sativa GN=... [more]
GLPF_BACSU4.492e-1333.16Glycerol uptake facilitator protein OS=Bacillus su... [more]
TIP41_ORYSJ5.867e-1330.77Probable aquaporin TIP4-1 OS=Oryza sativa subsp. j... [more]
GLPF_SHIFL5.867e-1331.77Glycerol uptake facilitator protein OS=Shigella fl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top