EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP7_MOUSE (Aquaporin-7 OS=Mus musculus GN=Aqp7 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.471e-12
Identity = 41/109 (37.61%), Postives = 59/109 (54.13%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA 546
            +++ +AE L TY M+  G  SV   +  E   S  G+++ +G  V + V+  G ISGAH N +VT  +    R  WK+ P Y+L Q LGS  AA T  L+F    + FA
Sbjct:   19 VREFLAEFLSTYVMMVFGLGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISGAHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYGAINHFA 127          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP43_MAIZE (Aquaporin TIP4-3 OS=Zea mays GN=TIP4-3 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.445e-11
Identity = 63/211 (29.86%), Postives = 94/211 (44.55%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPG----ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAG-LAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAV 831
            F + ++ E++ T+  +F G  + + +    K  +  G    +++   LVV V+  +  HISG H NP+VT++ A        +   YI  Q+L S+ A   LR L                 +Q  V E + TF L+FVI     D R +   AG L  G  V AN +    ++GASMN   S G +  S      W+Y V  L G   AV
Sbjct:   17 FFRGVLGELVLTFLFVFIGVGAAMTDGATTKGSTAGGDLTAVALGQALVVAVIATAGFHISGGHVNPAVTLSLAVGGHVTLFRSSLYIAAQMLASSAACFLLRWLTGGLATPVHALAEGVGPLQGVVAEAVFTFSLLFVIYATILDPRKLLPGAGPLLTGLLVGANSVAGAALSGASMNPARSFGPAVASGVWTHHWVYWVGPLAGGPLAV 227          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP31_ARATH (Aquaporin TIP3-1 OS=Arabidopsis thaliana GN=TIP3-1 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.445e-11
Identity = 59/215 (27.44%), Postives = 97/215 (45.12%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVVNLNNEKI----VSLPGISIVWGLVVMVLVYSLG---------HISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            +AE L T+  +FA   S+   L+ +K+     +  G +   GL+++ L ++           ++SG H NP+VT       R    +   Y + Q+LG+ LA   LRL     +            +   V+E I+TF L++V+     D +  ++G +A LA+G  V AN++   P +GASMN   + G +         WIY V    G   A
Sbjct:   27 LAEFLSTFVFVFAAEGSI---LSLDKLYWEHAAHAGTNTPGGLILVALAHAFALFAAVSAAINVSGGHVNPAVTFGALVGGRVTAIRAIYYWIAQLLGAILACLLLRLTTNGMRPVGFRLASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLAIGLIVGANILVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGSALA 238          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP2_HUMAN (Aquaporin-2 OS=Homo sapiens GN=AQP2 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.445e-11
Identity = 66/212 (31.13%), Postives = 99/212 (46.70%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLN-NEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTL-RLLFQEKQDQFA*TLXAGSNI--QAFVMEFIITFYLMFVISGVATDNRAIGELAG---LAVGFTVLANVMFARPITGASMNXQES--GASNCSKSDKGLWIYMVAHLYG 816
            S+ F + + AE L T   +F G  S    LN  + + S+  I++ +GL +  LV +LGHISGAH NP+VT+A          +   Y+  Q+LG+   A  L  +   + +   A    + S    QA  +E  +T  L+  I   +TD R  GE  G   L++GF+V    +     TG SMN   S   A    K D   W++ +  L G
Sbjct:    6 SIAFSRAVFAEFLATLLFVFFGLGSA---LNWPQALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQLVLCIF-ASTDERR-GENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDH-WVFWIGPLVG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: YFF4_YEAST (Uncharacterized membrane protein YFL054C OS=Saccharomyces cerevisiae GN=YFL054C PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.887e-11
Identity = 35/91 (38.46%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCA-SVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGS 489
            M++  AE LGT  ++  G   ++   +      S   +S  WG   M+ VY  G ISG H NP+VTI+ A  ++FPWK+VP YI+ Q++G+
Sbjct:  347 MREPFAEFLGTLVLVIFGVGGNLQATVTKGSGGSYESLSFAWGFGCMLGVYVAGGISGGHINPAVTISMAIFRKFPWKKVPVYIVAQIIGA 437          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP12_ARATH (Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 1.887e-11
Identity = 61/213 (28.64%), Postives = 95/213 (44.60%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCAS-VVVNLNNEKIVSLPGISIVWGLVVMVLVYSLG---------HISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQ-EKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATD--NRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            ++  +AE + T   +FAG  S +  N   +   + P      GLV   L ++ G         +ISG H NP+VT            +   Y + Q+LGS  A   L      E    F  +   GS + A V E ++TF L++ +   A D  N ++G +A +A+GF V AN++     +GASMN   + G +  S +    W+Y    L G
Sbjct:   21 LRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPS-----GLVAAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGS-LNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIG 227          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: PIP26_ARATH (Probable aquaporin PIP2-6 OS=Arabidopsis thaliana GN=PIP2-6 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.887e-11
Identity = 63/229 (27.51%), Postives = 99/229 (43.23%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKI---------VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQF---A*TLXAGSNIQAFV-MEFIITFYLMFVISGVATDNR-----AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GAS---NCSKSDKGLWIYMVAHLYGDCXAVGY 837
            F + ++AE + T   ++    +V+   +   I         V L GIS  +G ++ +LVY    ISG H NP+VT       +    +   Y++ Q LG+T   G +++      +++   A  L  G N+   V  E I TF L++ +       R      I  LA L +GF+V    +   PITG  +N   S GA+   N  K+    WI+ V    G   A  Y
Sbjct:   36 FYRAVIAEFIATLLFLYVTVLTVIGFKSQTDINAGGGACASVGLLGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLASKVSLVRAVSYMVAQCLGATCGVGLVKVFQSTYYNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINPARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFY 264          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: PDUF_SALTY (Propanediol diffusion facilitator OS=Salmonella typhimurium GN=pduF PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 2.465e-11
Identity = 61/191 (31.94%), Postives = 85/191 (44.50%), Query Frame = 1
Query:  235 AEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQF--A*TLXAGS------------------NI-QAFVMEFIITFYLMFVISGVATDNRAI--GELAGLAVGFTVLANVMFARPITGASMN 738
            AE LGT   +F G   +         + L  I I+WGL + + VY    ISG H NP+VTIA      FP ++V PYI+ Q  G+   A    +L+     +F  A  +  GS                  N+ QA ++E +IT  LM +I  +  D   I  G LA L +G  V        P+TG +MN
Sbjct:   11 AEFLGTGLFLFFGIGCLSALKVAGASLGLWEICIIWGLGISLAVYLTAGISGGHLNPAVTIALWLFACFPKQKVLPYIIAQFAGAFGGALLAYVLYSSLFTEFETAHHMVRGSVESLQLASIFSTYPAAALNVWQAALVEVVITSILMGMIMALTDDGNGIPKGPLAPLLIGILVAVIGASTGPLTGFAMN 201          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP11_ORYSJ (Probable aquaporin TIP1-1 OS=Oryza sativa subsp. japonica GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.219e-11
Identity = 61/208 (29.33%), Postives = 96/208 (46.15%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPGI---SIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE-KQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            ++  +AE + T   +FAG  S +    L      +  G+   ++     + V V    +ISG H NP+VT            +   Y + Q+LGST+A   LR          F   L   S  +A V+E ++TF L++ +   A D +  ++G +A +A+GF V AN++      GASMN   S G +  S S +  W+Y V  L G
Sbjct:   20 LKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIAAAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFLLRFSTGGLATGTFG--LTGVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIG 225          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP42_ORYSJ (Probable aquaporin TIP4-2 OS=Oryza sativa subsp. japonica GN=TIP4-2 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 4.204e-11
Identity = 60/211 (28.44%), Postives = 89/211 (42.18%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNE----KIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAV 831
            ++ +  E+L T+  +F G AS +          +  ++   ++   LVV VL  +  H+SG H NP+VT++ A        +   Y+  Q+ GS+LA   LR L                 +Q    E + TF L+ VI     D R  A      L  G  V AN +    +TGASMN   S G +  +      W+Y V  L G   AV
Sbjct:   23 LRAVAGELLFTFLFVFIGVASTITAGKAAGGAGEAAAVTAAAMAQALVVAVLATAGFHVSGGHLNPAVTLSLAVGGHITLFRSALYVAAQLAGSSLACLLLRCLTGGAATPVHALADGVGPVQGVAAEAVFTFTLLLVICATILDPRRAAPPGTGPLLTGLLVGANTVAGGALTGASMNPARSFGPALATGEWAHHWVYWVGPLAGGPLAV 233          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
AQP7_MOUSE8.471e-1237.61Aquaporin-7 OS=Mus musculus GN=Aqp7 PE=2 SV=1[more]
TIP43_MAIZE1.445e-1129.86Aquaporin TIP4-3 OS=Zea mays GN=TIP4-3 PE=2 SV=1[more]
TIP31_ARATH1.445e-1127.44Aquaporin TIP3-1 OS=Arabidopsis thaliana GN=TIP3-1... [more]
AQP2_HUMAN1.445e-1131.13Aquaporin-2 OS=Homo sapiens GN=AQP2 PE=1 SV=1[more]
YFF4_YEAST1.887e-1138.46Uncharacterized membrane protein YFL054C OS=Saccha... [more]
TIP12_ARATH1.887e-1128.64Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2... [more]
PIP26_ARATH1.887e-1127.51Probable aquaporin PIP2-6 OS=Arabidopsis thaliana ... [more]
PDUF_SALTY2.465e-1131.94Propanediol diffusion facilitator OS=Salmonella ty... [more]
TIP11_ORYSJ3.219e-1129.33Probable aquaporin TIP1-1 OS=Oryza sativa subsp. j... [more]
TIP42_ORYSJ4.204e-1128.44Probable aquaporin TIP4-2 OS=Oryza sativa subsp. j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top