EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_VIBVU (Aquaporin Z OS=Vibrio vulnificus GN=aqpZ PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.149e-23
Identity = 73/224 (32.59%), Postives = 111/224 (49.55%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYGD-CXAVGYK 840
            M K +AE+ GT++++  GC S V+      + + L G+S+ +GL V+ + +++GHISG H NP+VTI      RF  K++ PYIL QV+G  +A G L  +   +    A +    SN              A V E ++T   + VI G ATD RA    A +A+G  +    + + P+T  S+N   S        D     LW++ VA + G    AV YK
Sbjct:    1 MNKYLAELFGTFWLVLGGCGSAVLAAAFPDVGIGLLGVSLAFGLTVLTMAFAIGHISGCHLNPAVTIGLWAGGRFEAKEIVPYILAQVIGGVIAGGVLYTIASGQMGFDATSSGFASNGYGEHSPGGYSLTSALVTEVVMTMMFLLVILG-ATDQRAPQGFAPIAIGLCLTLIHLISIPVTNTSVNPARSTGVALYVGDWATAQLWLFWVAPILGALLGAVAYK 223          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_PSEPK (Aquaporin Z OS=Pseudomonas putida (strain KT2440) GN=aqpZ PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 3.666e-23
Identity = 65/212 (30.66%), Postives = 113/212 (53.30%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEK----------QDQFA*TLXAGSNIQA-FVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            +++ AE++GT++++  GC S V+  ++   + + G++  +GL V+ + +++GHISG H NP+V+       RFP K++ PY++ QV+G+ LAAG + L+   K           + +A     G  + A FV E ++T   + VI G ATD RA    A +A+G  +    + + P+T  S+N   S            + LW++ VA L G
Sbjct:    5 KRMGAELIGTFWLVLGGCGSAVLAASSPLGIGVLGVAFAFGLTVLTMAFAIGHISGCHLNPAVSFGLVVGGRFPAKELLPYVIAQVIGAILAAGVIYLIASGKAGFELSAGLASNGYADHSPGGYTLGAGFVSEVVMTAMFLVVIMG-ATDARAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTGPALFVGGWALQQLWLFWVAPLIG 215          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_VIBVY (Aquaporin Z OS=Vibrio vulnificus (strain YJ016) GN=aqpZ PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 6.253e-23
Identity = 72/224 (32.14%), Postives = 110/224 (49.11%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYGD-CXAVGYK 840
            M K +AE+ GT++++  GC S V+      + + L G+S+ +GL V+ + +++GHISG H NP+VTI      RF  K++ PYIL QV+G  +A G L  +   +    A +    SN              A V E ++    + VI G ATD RA    A +A+G  +    + + P+T  S+N   S        D     LW++ VA + G    AV YK
Sbjct:    1 MNKYLAELFGTFWLVLGGCGSAVLAAAFPDVGIGLLGVSLAFGLTVLTMAFAIGHISGCHLNPAVTIGLWAGGRFEAKEIVPYILAQVIGGVIAGGVLYTIASGQMGFDATSSGFASNGYGEHSPGGYSLTSALVTEIVMAMMFLLVILG-ATDQRAPQGFAPIAIGLCLTLIHLISIPVTNTSVNPARSTGVALYVGDWATAQLWLFWVAPILGALLGAVAYK 223          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_VIBPA (Aquaporin Z OS=Vibrio parahaemolyticus GN=aqpZ PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.819e-22
Identity = 73/224 (32.59%), Postives = 112/224 (50.00%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLL------FQEKQDQFA------*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYGD-CXAVGYK 840
            M K +AE  GT++++  GC S V+      + + L G+++ +GL V+ + +++GHISG H NP+VT+      RF  K V PYI+ QV+G  +A G L ++      F      FA       +    S + A V E ++T   + VI G ATD RA    A +A+G  +    + + P+T  S+N   S A      D     LW++ VA + G    AV YK
Sbjct:    1 MNKYLAEAFGTFWLVLGGCGSAVLAAGFPDVGIGLLGVALAFGLTVLTMAFAIGHISGCHLNPAVTVGLWAGGRFDTKDVAPYIIAQVIGGLIAGGILYVIATGQAGFDVVGSGFAANGYGEHSPGQYSMLAALVSEIVMTMMFLIVIMG-ATDKRAPQGFAPIAIGLCLTLIHLISIPVTNTSVNPARSTAVAMYVGDWAVSQLWLFWVAPIVGGVLGAVIYK 223          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_SHIFL (Aquaporin Z OS=Shigella flexneri GN=aqpZ PE=3 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 4.053e-22
Identity = 67/214 (31.31%), Postives = 109/214 (50.93%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            +KL AE  GT++++F GC S V+     ++ +   G+++ +GL V+ + +++GHISG HFNP+VTI      RFP K+V  Y++ QV+G  +AA  L L+   K    A      SN            + A V+E +++   + VI G ATD  A    A +A+G  +    + + P+T  S+N   S A    +     + LW + V  + G
Sbjct:    3 RKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISGGHFNPAVTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFASNGYGEHSPGGYSMLSALVVELVLSAGFLLVIHG-ATDKFAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVG 215          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_ECOLI (Aquaporin Z OS=Escherichia coli (strain K12) GN=aqpZ PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.053e-22
Identity = 67/214 (31.31%), Postives = 109/214 (50.93%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            +KL AE  GT++++F GC S V+     ++ +   G+++ +GL V+ + +++GHISG HFNP+VTI      RFP K+V  Y++ QV+G  +AA  L L+   K    A      SN            + A V+E +++   + VI G ATD  A    A +A+G  +    + + P+T  S+N   S A    +     + LW + V  + G
Sbjct:    3 RKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISGGHFNPAVTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFASNGYGEHSPGGYSMLSALVVELVLSAGFLLVIHG-ATDKFAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVG 215          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_ECOL6 (Aquaporin Z OS=Escherichia coli O6 GN=aqpZ PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.053e-22
Identity = 67/214 (31.31%), Postives = 109/214 (50.93%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            +KL AE  GT++++F GC S V+     ++ +   G+++ +GL V+ + +++GHISG HFNP+VTI      RFP K+V  Y++ QV+G  +AA  L L+   K    A      SN            + A V+E +++   + VI G ATD  A    A +A+G  +    + + P+T  S+N   S A    +     + LW + V  + G
Sbjct:    3 RKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISGGHFNPAVTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFASNGYGEHSPGGYSMLSALVVELVLSAGFLLVIHG-ATDKFAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVG 215          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_ECO57 (Aquaporin Z OS=Escherichia coli O157:H7 GN=aqpZ PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.053e-22
Identity = 67/214 (31.31%), Postives = 109/214 (50.93%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            +KL AE  GT++++F GC S V+     ++ +   G+++ +GL V+ + +++GHISG HFNP+VTI      RFP K+V  Y++ QV+G  +AA  L L+   K    A      SN            + A V+E +++   + VI G ATD  A    A +A+G  +    + + P+T  S+N   S A    +     + LW + V  + G
Sbjct:    3 RKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISGGHFNPAVTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFASNGYGEHSPGGYSMLSALVVELVLSAGFLLVIHG-ATDKFAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVG 215          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_SHEON (Aquaporin Z OS=Shewanella oneidensis GN=aqpZ PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.179e-21
Identity = 66/214 (30.84%), Postives = 106/214 (49.53%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            QK+ AE LGT +++  GC S V+     ++ + L G+S+ +GL V+ + +++GHISG H NP+V+       RFP  ++ PYI+ QV G    AG L L+    Q+ F+      SN            I   + E ++T + + VI G +TD RA    A +A+G  +    + + PI+  S+N   S        D     LW++  A + G
Sbjct:    3 QKMAAEFLGTLWLVLGGCGSAVLAAAFPEVGIGLLGVSLAFGLTVLTMAFAIGHISGCHLNPAVSFGLWAGGRFPTSELLPYIIAQVAGGIAGAGVLYLI-ASGQEGFSLAAGFASNGFGEHSPGGYSMISVMICEIVMTLFFLLVILG-STDERAPKGFAPIAIGLCLTLIHLISIPISNTSVNPARSTGPALFVGDWAVSQLWLFWAAPIIG 214          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_GLOVI (Aquaporin Z OS=Gloeobacter violaceus GN=aqpZ PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.627e-21
Identity = 69/235 (29.36%), Postives = 118/235 (50.21%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYGDCXAVGYKWGKFLTAFGKIT 876
            +++ +AE +GT++++  GC + V+      + +   G+S+ +GL ++ + +++GHISG H NP+V+I     KRFP  ++ PYI  QVLG    AG L L+   K   F+ +    SN            +   V E ++TF  + +I G +TD RA    A +A+G ++    + + P+T  S+N   S        D     LW++ +A + G   A G  +  FL   G+ T
Sbjct:    4 VKRSVAEFIGTFWLVLGGCGAAVLAAAFPNLGIGFAGVSLAFGLTLLTMAFAIGHISGCHINPAVSIGLWAAKRFPATELLPYIAAQVLGGIAGAGVLYLIAGGKAG-FSLSGGFASNGYGLHSPGGYTLLACLVCEVVMTFMFLMIILG-STDRRAPKGFAPIAIGLSLTLIHLISIPVTNTSVNPARSTGPALFVGDWAIAELWLFWLAPIVGAALA-GLFYHAFLDEPGEET 235          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
AQPZ_VIBVU2.149e-2332.59Aquaporin Z OS=Vibrio vulnificus GN=aqpZ PE=3 SV=1[more]
AQPZ_PSEPK3.666e-2330.66Aquaporin Z OS=Pseudomonas putida (strain KT2440) ... [more]
AQPZ_VIBVY6.253e-2332.14Aquaporin Z OS=Vibrio vulnificus (strain YJ016) GN... [more]
AQPZ_VIBPA1.819e-2232.59Aquaporin Z OS=Vibrio parahaemolyticus GN=aqpZ PE=... [more]
AQPZ_SHIFL4.053e-2231.31Aquaporin Z OS=Shigella flexneri GN=aqpZ PE=3 SV=2[more]
AQPZ_ECOLI4.053e-2231.31Aquaporin Z OS=Escherichia coli (strain K12) GN=aq... [more]
AQPZ_ECOL64.053e-2231.31Aquaporin Z OS=Escherichia coli O6 GN=aqpZ PE=3 SV... [more]
AQPZ_ECO574.053e-2231.31Aquaporin Z OS=Escherichia coli O157:H7 GN=aqpZ PE... [more]
AQPZ_SHEON1.179e-2130.84Aquaporin Z OS=Shewanella oneidensis GN=aqpZ PE=3 ... [more]
AQPZ_GLOVI2.627e-2129.36Aquaporin Z OS=Gloeobacter violaceus GN=aqpZ PE=3 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top