EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_THEMA (3-oxoacyl-[acyl-carrier-protein] reductase OS=Thermotoga maritima GN=fabG PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.800e-20
Identity = 75/236 (31.78%), Postives = 119/236 (50.42%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGA+SG+G+   L  A+ G  ++A     + L SL  E     G   +     L+V+     I+  V+   + +GRID LVNNAG++      + + EE+W+ ++  NL G + V++ V   M    + GS++N+SS+        PG   YA+SKAG+  MTK  + EL    IRVN++ PG  ++ +TE L +K      A    PL  FG  +  +  ++ +L  D S    G
Sbjct:   11 TGAASGIGKATTLLFAQEGATVIAGDISKENLDSLVKEAEGLPG---KVDPYVLNVTDRDQ-IKEVVEKVVQKYGRIDVLVNNAGITRDALL-VRMKEEDWDAVINVNLKGVFNVTQMVVPYMIK-QRNGSIVNVSSVVGIYGN--PGQTNYAASKAGVIGMTKTWAKELAGRNIRVNAVAPGFIETPMTEKLPEK--ARETALSRIPLGRFGKPE-EVAQVILFLASDESSYVTG 235          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHG2_BACSU (Glucose 1-dehydrogenase 2 OS=Bacillus subtilis GN=ycdF PE=1 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 1.800e-20
Identity = 71/236 (30.08%), Postives = 117/236 (49.58%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG+S G+G+       K    +V              EI KQ+G   +A++VE DVS     I+  +  A E FG +D +VNN+G +G    P +++ E+W  ++  N+TG++L +K     M   N +G+V+NISS+    +   P  V Y++SK G+  MT+ L+L      IRVN+I PG   +E      KK+       +  P++ FG  +  + +   +LV + +    G
Sbjct:   13 TGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGADETLEIIKQNGG--KAVSVEADVSKE-EGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHEMSLEDWQRVIDVNVTGTFLGAKAALNHMMKNNIKGNVLNISSV--HQQIPRPVNVQYSTSKGGIKMMTETLALNYADKGIRVNAIAPGTIATESNVD-TKKEESRQKQLKKIPMKAFGKPE-EVAAAAAWLVSEEASYVTG 241          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YOHF_ECOLI (Uncharacterized oxidoreductase yohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 1.167e-19
Identity = 82/248 (33.06%), Postives = 125/248 (50.40%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVS---ANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSP-LDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSLLILG 733
            T + SG+G+E  L LA+ G  I       +  +   D   +     VRA  V+LD+        A+E  +Q      GRID LVNNAG     K+P LD+  +EW  I   ++ G++L S+    +M    Q G +INI+S+   +   LP   AY ++K  L  +TK ++LEL  HKI VN++ PG   + +  G+   D +   A  + PLR FG T   + SLV +L  + ++   G  SL++ G
Sbjct:    8 TASDSGIGKECALLLAQQGFDIGITWHSDE--EGAKDTAREVVSHGVRAEIVQLDLGNLPEGALALEKLIQR----LGRIDVLVNNAGAM--TKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARQMVKQGQGGRIINITSVHEHT--PLPDASAYTAAKHALGGLTKAMALELVRHKILVNAVAPGAIATPM-NGMDDSD-VKPDAEPSIPLRRFGATH-EIASLVVWLCSEGANYTTGQ-SLIVDG 241          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG1_SYNY3 (3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803) GN=fabG1 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.167e-19
Identity = 72/235 (30.64%), Postives = 121/235 (51.49%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMY 703
            TGAS G+G+   L LA  G ++V   A+      ++  EI    G    A+AV+ +V AN   ++  ++   + F RID LVNNAG++      L +  E+W  ++  NLTG +L +K V  ++    + G +INI+S+A       PG   Y+++KAG+   TK ++ EL    + VN++ PG   +++TE L  +  L  +     PL  +G  +  +   +R+L  D +  Y
Sbjct:   12 TGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGE---AIAVQANV-ANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLL-LRMKLEDWQAVIDLNLTGVFLCTKAVS-KLMLKQKSGRIINITSVAGMMGN--PGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNAEPILQFI-----PLARYGQPE-EVAGTIRFLATDPAAAY 232          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_CUPLA (3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.190e-19
Identity = 71/237 (29.96%), Postives = 121/237 (51.05%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMY 703
            TGAS G+G+   L L KAGC++ V  AR     + +  EI    G   +A+    DVS     +E  ++ A +A+G +D LVNNAG++  G +   + + + +W  ++  NLTG +L ++    ++    ++G +INI+S+         G   Y+++KAG+   TK ++ E     I VN++ PG   S++T  L   D +N     T PL  +G  +  +  LV +L  + +  Y
Sbjct:   83 TGASRGIGKAIALSLGKAGCKVLVNYARSSKEAEEVSKEIEAFGG---QALTFGGDVSKE-EDVEAMIKTAVDAWGTVDILVNNAGITRDGLL---MRMKKSQWQEVIDLNLTGVFLCTQ-AAAKIMMKKKKGRIINIASVVGLVGNA--GQANYSAAKAGVIGFTKTVAREYASRNINVNAVAPGFISSDMTSKL--GDDINKKILETIPLGRYGQPE-EVAGLVEFLAINPASSY 306          

HSP 2 Score: 21.9422 bits (45), Expect = 1.190e-19
Identity = 7/14 (50.00%), Postives = 10/14 (71.43%), Query Frame = 1
Query:  697 YVSGHIFIVDSGAT 738
            YV+G +F +D G T
Sbjct:  306 YVTGQVFTIDGGMT 319          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CBR2_PIG (Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.524e-19
Identity = 73/238 (30.67%), Postives = 115/238 (48.32%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSP-LDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TGA  G+GR+    L  +G R+VA  R    L SL  E        +  + V+L           + + A    G +D LVNNA V  A+  P LD T+E ++     NL   + VS+ V   M +    GS++N+SS+   S    PG  AY+S+K  +  +TK +++ELG HKIRVNS+ P +  + +   +     L       +P+R F   +  + S++ +L+ D S    G+
Sbjct:   13 TGAGKGIGRDTVKALHVSGARVVAVTRTNGDLVSLSQEC-----PGIEPVCVDL-------GDWEATERALGGVGPVDLLVNNAAV--ALMQPFLDTTKEVFDRSFNVNLRSVFQVSQIVARSMIERGVPGSIVNVSSMV--SHVTYPGLAAYSSTKGAMTMLTKSMAMELGPHKIRVNSVNPTVVLTAMGRSVTSDPELARKLKERHPMRKFAEVEDVVNSIL-FLLSDRSASTSGS 233          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_AQUAE (3-oxoacyl-[acyl-carrier-protein] reductase OS=Aquifex aeolicus GN=fabG PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.599e-19
Identity = 68/236 (28.81%), Postives = 126/236 (53.39%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG++ G+GR     LA AG  ++      +R K++ +EI  + G  V+A  VE+++ +   +I  + +  +     ID LVNNAG++   K  L ++  +W  ++K NLTG++LV++   +R     + G ++NISS+   +     G V Y+++KAGL   TK L+ EL    + VN++ PG  ++++T  L ++  +        PL  FG+ +  + ++V +L  + +    G
Sbjct:   13 TGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYG--VKAHGVEMNLLSE-ESINKAFEEIYNLVDGIDILVNNAGITRD-KLFLRMSLLDWEEVLKVNLTGTFLVTQN-SLRKMIKQRWGRIVNISSVVGFTGNV--GQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEE--IKQKYKEQIPLGRFGSPE-EVANVVLFLCSELASYITG 238          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y5909_MYXXD (Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 3.394e-19
Identity = 74/190 (38.95%), Postives = 105/190 (55.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGASSGLGR   L LA+ G R+ AA RR+ +L++L DE      + V    VELDV+   A +E    +  EA G +D +V NAGV G   +   L  E    I+ TN+TG+      V  +M +  + G ++ +SS+A   RG L G  AY++SKA L+   + L ++L    +RV  I PG  KSE+T
Sbjct:   12 TGASSGLGRGLALWLARRGVRVFAAGRRLPQLQALRDE---AQAAGVTVEPVELDVTKADATLERIRALDAEA-GGLDLVVANAGVGGTTNAK-RLPWERVRGIIDTNVTGAAATLSAVLPQMVE-RKRGHLVGVSSLAG-FRG-LAGHAAYSASKAFLSTFMESLRVDLRGTGVRVTCIYPGFVKSELT 193          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_VIBCH (3-oxoacyl-[acyl-carrier-protein] reductase OS=Vibrio cholerae GN=fabG PE=3 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 3.394e-19
Identity = 60/193 (31.09%), Postives = 107/193 (55.44%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TGAS G+G+     LA+ G +++  A      +++ D +    G + + MA+ +    N  +IE  ++   + FG +D LVNNAG++      + + EEEW+ IM+TNLT  + +SK V +R     ++G +IN+ S+  T      G   YA++KAG+   TK ++ E+    + VN++ PG  ++++T+ L
Sbjct:   11 TGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYL----GDNGKGMALNV---TNPESIEAVLKAITDEFGGVDILVNNAGITRD-NLLMRMKEEEWSDIMETNLTSIFRLSKAV-LRGMMKKRQGRIINVGSVVGTMGNA--GQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKAL 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: TRN1_DATST (Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.789e-19
Identity = 67/197 (34.01%), Postives = 104/197 (52.79%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TG S G+G     +LA  G R+   +R    L   C EI ++ G +V     +L        +  +V   ++  G+++ LVNNAGV    K   D TE+++N IM TN   ++ +S+ +   +  A+Q G+VI +SSIA  S   LP    Y++SK  +N MTK L+ E     IRVNS+ PG+  + + E  +KK+
Sbjct:   27 TGGSKGIGYAIVEELAGLGARVYTCSRNEKELDE-CLEIWREKGLNVEGSVCDLLSRTERDKLMQTVAHVFD--GKLNILVNNAGVV-IHKEAKDFTEKDYNIIMGTNFEAAYHLSQ-IAYPLLKASQNGNVIFLSSIAGFSA--LPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKN 216          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
FABG_THEMA1.800e-2031.783-oxoacyl-[acyl-carrier-protein] reductase OS=Ther... [more]
DHG2_BACSU1.800e-2030.08Glucose 1-dehydrogenase 2 OS=Bacillus subtilis GN=... [more]
YOHF_ECOLI1.167e-1933.06Uncharacterized oxidoreductase yohF OS=Escherichia... [more]
FABG1_SYNY31.167e-1930.643-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Sy... [more]
FABG_CUPLA1.190e-1929.963-oxoacyl-[acyl-carrier-protein] reductase, chloro... [more]
CBR2_PIG1.524e-1930.67Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2... [more]
FABG_AQUAE2.599e-1928.813-oxoacyl-[acyl-carrier-protein] reductase OS=Aqui... [more]
Y5909_MYXXD3.394e-1938.95Uncharacterized oxidoreductase MXAN_5909 OS=Myxoco... [more]
FABG_VIBCH3.394e-1931.093-oxoacyl-[acyl-carrier-protein] reductase OS=Vibr... [more]
TRN1_DATST5.789e-1934.01Tropinone reductase 1 OS=Datura stramonium GN=TR1 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top