EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PECR_HUMAN (Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 7.561e-19
Identity = 60/190 (31.58%), Postives = 105/190 (55.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVS-ANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE 565
            TG ++G+G+    +L + G  +V A+R+++RLKS  DE+      + +A  + +  +  N   + N V+   + FG+I+ LVNN G  G   SP + ++ + W+ +++TNLTG++ + K V          GS++NI  I  T  G  P  V   +++AG+  +TK L+LE     IR+N + PG+  S+
Sbjct:   24 TGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGG--GQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWM-KEHGGSIVNI--IVPTKAG-FPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQ 207          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_STAAW (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.290e-18
Identity = 72/237 (30.38%), Postives = 114/237 (48.10%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+GR   L LA+ G  + V  A   ++ +++ +EI  +   S    A   D     A I+  V      FG +D LVNNAG++      + + E+EW+ ++ TNL G +   +    +M    + G++IN+SS+        PG   Y ++KAG+  +TK  + EL    I VN++ PG   S++T+ L   D L        PL  FG  D  + + V +L  D +    G
Sbjct:   10 TGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQ----FGSLDVLVNNAGITRD-NLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQML-RQRSGAIINLSSVVGAVGN--PGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL--SDELKEQMLTQIPLARFG-QDTDIANTVAFLASDKAKYITG 235          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_STAAS (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.290e-18
Identity = 72/237 (30.38%), Postives = 114/237 (48.10%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+GR   L LA+ G  + V  A   ++ +++ +EI  +   S    A   D     A I+  V      FG +D LVNNAG++      + + E+EW+ ++ TNL G +   +    +M    + G++IN+SS+        PG   Y ++KAG+  +TK  + EL    I VN++ PG   S++T+ L   D L        PL  FG  D  + + V +L  D +    G
Sbjct:   10 TGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQ----FGSLDVLVNNAGITRD-NLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQML-RQRSGAIINLSSVVGAVGN--PGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL--SDELKEQMLTQIPLARFG-QDTDIANTVAFLASDKAKYITG 235          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_STAAR (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.290e-18
Identity = 72/237 (30.38%), Postives = 114/237 (48.10%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+GR   L LA+ G  + V  A   ++ +++ +EI  +   S    A   D     A I+  V      FG +D LVNNAG++      + + E+EW+ ++ TNL G +   +    +M    + G++IN+SS+        PG   Y ++KAG+  +TK  + EL    I VN++ PG   S++T+ L   D L        PL  FG  D  + + V +L  D +    G
Sbjct:   10 TGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQ----FGSLDVLVNNAGITRD-NLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQML-RQRSGAIINLSSVVGAVGN--PGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL--SDELKEQMLTQIPLARFG-QDTDIANTVAFLASDKAKYITG 235          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_STAAN (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.290e-18
Identity = 72/237 (30.38%), Postives = 114/237 (48.10%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+GR   L LA+ G  + V  A   ++ +++ +EI  +   S    A   D     A I+  V      FG +D LVNNAG++      + + E+EW+ ++ TNL G +   +    +M    + G++IN+SS+        PG   Y ++KAG+  +TK  + EL    I VN++ PG   S++T+ L   D L        PL  FG  D  + + V +L  D +    G
Sbjct:   10 TGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQ----FGSLDVLVNNAGITRD-NLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQML-RQRSGAIINLSSVVGAVGN--PGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL--SDELKEQMLTQIPLARFG-QDTDIANTVAFLASDKAKYITG 235          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_STAAM (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.290e-18
Identity = 72/237 (30.38%), Postives = 114/237 (48.10%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+GR   L LA+ G  + V  A   ++ +++ +EI  +   S    A   D     A I+  V      FG +D LVNNAG++      + + E+EW+ ++ TNL G +   +    +M    + G++IN+SS+        PG   Y ++KAG+  +TK  + EL    I VN++ PG   S++T+ L   D L        PL  FG  D  + + V +L  D +    G
Sbjct:   10 TGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQ----FGSLDVLVNNAGITRD-NLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQML-RQRSGAIINLSSVVGAVGN--PGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL--SDELKEQMLTQIPLARFG-QDTDIANTVAFLASDKAKYITG 235          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_STAAC (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 1.290e-18
Identity = 72/237 (30.38%), Postives = 114/237 (48.10%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+GR   L LA+ G  + V  A   ++ +++ +EI  +   S    A   D     A I+  V      FG +D LVNNAG++      + + E+EW+ ++ TNL G +   +    +M    + G++IN+SS+        PG   Y ++KAG+  +TK  + EL    I VN++ PG   S++T+ L   D L        PL  FG  D  + + V +L  D +    G
Sbjct:   10 TGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQ----FGSLDVLVNNAGITRD-NLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQML-RQRSGAIINLSSVVGAVGN--PGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL--SDELKEQMLTQIPLARFG-QDTDIANTVAFLASDKAKYITG 235          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_CHLTR (3-oxoacyl-[acyl-carrier-protein] reductase OS=Chlamydia trachomatis GN=fabG PE=1 SV=3)

HSP 1 Score: 93.9745 bits (232), Expect = 1.290e-18
Identity = 76/239 (31.80%), Postives = 115/239 (48.12%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG S G+G       A+ G  +       +  ++    +++Q+G  V    V  DVS N   +   VQ     +  ID +VNNAG++      + ++EEEW+ ++ TNL   + V   V IR     + G++INISSI    RG  PG   YA++KAG+   +K LS E+G   IRVN I PG   +++T+ L   +K +WL  V     PL   G  +  +     +L  D S    G
Sbjct:   13 TGGSRGIGFSIAKLFAEQGANVQIWGINGEAGQAAAQTLSEQTGRQVSFALV--DVSKNDM-VSAQVQNFLAEYNTIDVIVNNAGITRDALL-MRMSEEEWSSVINTNLGSIYNVCSAV-IRPMIKARSGAIINISSIVGL-RGS-PGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTKSLNDNLKNEWLKGV-----PLGRVGMPE-EIAKAALFLASDGSSYITG 238          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y1385_MYCBO (Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis GN=fabG2 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.684e-18
Identity = 68/237 (28.69%), Postives = 121/237 (51.05%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TG + GLG          G R+V     ++  +       K+ G    A+AV  DV+     ++  ++ A E FG +D +VNNAG++    +   +TEE+++ ++  +L G+W  ++     MR+  + G+++N+SS++   +  + G   Y+++KAG+  MTK  + EL    IRVN+I PGL +S +TE + ++ W   +A    P+   G     + S+  +L  D S    GT
Sbjct:   13 TGGAQGLGLAIGQRFVAEGARVVLGDVNLEATEVAA----KRLGGDDVALAVRCDVT-QADDVDILIRTAVERFGGLDVMVNNAGITRDA-TMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRE-RKRGAIVNMSSVSG--KVGMVGQTNYSAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRSAMTEAMPQRIWDQKLAE--VPMGRAGEPS-EVASVAVFLASDLSSYMTGT 237          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y1350_MYCTU (Uncharacterized oxidoreductase Rv1350/MT1393 OS=Mycobacterium tuberculosis GN=fabG2 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.684e-18
Identity = 68/237 (28.69%), Postives = 121/237 (51.05%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TG + GLG          G R+V     ++  +       K+ G    A+AV  DV+     ++  ++ A E FG +D +VNNAG++    +   +TEE+++ ++  +L G+W  ++     MR+  + G+++N+SS++   +  + G   Y+++KAG+  MTK  + EL    IRVN+I PGL +S +TE + ++ W   +A    P+   G     + S+  +L  D S    GT
Sbjct:   13 TGGAQGLGLAIGQRFVAEGARVVLGDVNLEATEVAA----KRLGGDDVALAVRCDVT-QADDVDILIRTAVERFGGLDVMVNNAGITRDA-TMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRE-RKRGAIVNMSSVSG--KVGMVGQTNYSAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRSAMTEAMPQRIWDQKLAE--VPMGRAGEPS-EVASVAVFLASDLSSYMTGT 237          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
PECR_HUMAN7.561e-1931.58Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sa... [more]
FABG_STAAW1.290e-1830.383-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAS1.290e-1830.383-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAR1.290e-1830.383-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAN1.290e-1830.383-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAM1.290e-1830.383-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAC1.290e-1830.383-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_CHLTR1.290e-1831.803-oxoacyl-[acyl-carrier-protein] reductase OS=Chla... [more]
Y1385_MYCBO1.684e-1828.69Uncharacterized oxidoreductase Mb1385 OS=Mycobacte... [more]
Y1350_MYCTU1.684e-1828.69Uncharacterized oxidoreductase Rv1350/MT1393 OS=My... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top