EY659218

Overview
NameEY659218
Unique NameEY659218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2470 contig Csv1_Contig2470:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_ANAVT (60 kDa chaperonin 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=groL1 PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.868e-84
Identity = 159/269 (59.11%), Postives = 206/269 (76.58%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+IVNDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++ EG++ VAAGAN +L+ RGI+K +  LV  +K+ ++ VEDS+ +A V ++SAGN+ EVG MIAEAM KVG++GV++LEEGKS    L + EGM+FD+GYISPYF TD E+M   ++   LLL DKKI   +DL+ VLE   R   P++IIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALERGIDILAEAVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAIVKEGLRNVAAGANAILLKRGIDKATGFLVDRIKEHARPVEDSKSIAQVGSISAGNDDEVGQMIAEAMDKVGKEGVISLEEGKSVTTELEITEGMRFDKGYISPYFATDPERMEAIFDEPFLLLTDKKIALVQDLVPVLEQVARAGRPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_ANASP (60 kDa chaperonin 1 OS=Anabaena sp. (strain PCC 7120) GN=groL1 PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.868e-84
Identity = 159/269 (59.11%), Postives = 206/269 (76.58%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+IVNDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++ EG++ VAAGAN +L+ RGI+K +  LV  +K+ ++ VEDS+ +A V ++SAGN+ EVG MIAEAM KVG++GV++LEEGKS    L + EGM+FD+GYISPYF TD E+M   ++   LLL DKKI   +DL+ VLE   R   P++IIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALERGIDILAEAVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAIVKEGLRNVAAGANAILLKRGIDKATGFLVDRIKEHARPVEDSKSIAQVGSISAGNDDEVGQMIAEAMDKVGKEGVISLEEGKSVTTELEITEGMRFDKGYISPYFATDPERMEAIFDEPFLLLTDKKIALVQDLVPVLEQVARAGRPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_SYNY3 (60 kDa chaperonin 2 OS=Synechocystis sp. (strain PCC 6803) GN=groL2 PE=1 SV=4)

HSP 1 Score: 311.227 bits (796), Expect = 4.891e-84
Identity = 156/263 (59.32%), Postives = 203/263 (77.19%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            + L+ G+N LAD V +TLGPKGRNV+LE +YGAP+IVNDG+TVAKE+EL +P EN GAKL+++ A+KT ++AGDGTTT+ ++AQ L+ EG++ VAAGANPV + RGIEK +  LV E++ ++K VE S +A VA VS+GN+ EVG MIA+AM KV + GV+T+EE KS    L VVEGMQ DRGYISPYF+TDS++  VE++N  +L+ DKKI+   +L+ VLE   R   P+LIIAEDIE EAL TLVVNK RG L  AA+K
Sbjct:   13 RSLEAGINALADAVRITLGPKGRNVLLEKQYGAPQIVNDGITVAKEIELSNPEENAGAKLIQEVASKTKEIAGDGTTTATIIAQALVREGLRNVAAGANPVALRRGIEKVTTFLVQEIEAVAKPVEGSAIAQVATVSSGNDPEVGAMIADAMDKVTKDGVITVEESKSLNTELEVVEGMQIDRGYISPYFITDSDRQLVEFDNPLILITDKKISAIAELVPVLEAVARAGRPLLIIAEDIEGEALATLVVNKARGVLNVAAIK 275          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_SYNY3 (60 kDa chaperonin 1 OS=Synechocystis sp. (strain PCC 6803) GN=groL1 PE=1 SV=4)

HSP 1 Score: 311.227 bits (796), Expect = 4.891e-84
Identity = 156/269 (57.99%), Postives = 209/269 (77.70%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+G+P+I+NDG+T+AKE+ELED VEN G  L+RQAA+KTND+AGDGTTT+ VLA  ++ EG++ VAAGANP+ + RGI+K +  LV+ +K+ ++ V DS+ +A V A+SAGN+ EVG MIA AM KVG++GV++LEEGKS    L + EGM+FD+GYISPYFVTD+E+M    E+ ++L+ DKKI   +DL+ +LE   R   P+LIIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALERGMDILAEAVAVTLGPKGRNVVLEKKFGSPQIINDGITIAKEIELEDHVENTGVSLIRQAASKTNDVAGDGTTTATVLAHAIVKEGLRNVAAGANPISLKRGIDKATDFLVARIKEHAQPVGDSKAIAQVGAISAGNDEEVGQMIANAMDKVGQEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDAERMEAVLEDPRILITDKKINLVQDLVPILEQVARQGKPLLIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_GLOVI (60 kDa chaperonin 1 OS=Gloeobacter violaceus GN=groL1 PE=3 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 4.891e-84
Identity = 159/269 (59.11%), Postives = 210/269 (78.07%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+I+NDGVT+AKE+ELE+ +EN GA+L+++ A+KTND+AGDGTTT+ VLAQ L+ EG+K VAAG+NP+ + RG+EKT + LV+EL++++K VE S+ +A VAAVSAGN+ E+G MIA AM  VG++GV+T+EE KS    L V EGMQFDRGY+SPY VTD E+M   ++   LL+ DKKI+   DL+ +LE   R   P++IIAEDIE+EAL TLVVNKLRG L  AA+K  G
Sbjct:   11 ARRALERGIDALANAVRVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELENKLENTGAQLIKEVASKTNDVAGDGTTTACVLAQSLVKEGLKNVAAGSNPMNLKRGMEKTVRHLVAELEKVAKPVEGSQAIAQVAAVSAGNDDEIGEMIARAMETVGKEGVITVEESKSLTTELEVTEGMQFDRGYVSPYLVTDQERMEAVFDEPFLLITDKKISIITDLVPILEKVARAGRPLVIIAEDIEKEALATLVVNKLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_THEVL (60 kDa chaperonin 1 OS=Thermosynechococcus vulcanus GN=groL1 PE=3 SV=2)

HSP 1 Score: 309.686 bits (792), Expect = 1.423e-83
Identity = 157/269 (58.36%), Postives = 208/269 (77.32%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+IVNDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++ EG++ VAAGANP+ + RGI+K ++ LV ++ + ++ VEDS+ +A VAA+SAGN+ EVG MIA+AM KVG++GV++LEE KS    L V EGM+FD+GYISPYF TD+E+M    +   +L+ DKKIT  +DL+ +LE   R   P++IIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALEKGMDILAESVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKEGLRNVAAGANPIALKRGIDKATQFLVEKIAEHARPVEDSKAIAQVAAISAGNDEEVGRMIADAMDKVGKEGVISLEEAKSMTTELEVTEGMRFDKGYISPYFATDTERMEAVLDEPFVLVTDKKITLVQDLVPILEQVARAGKPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_SYNAS (60 kDa chaperonin 2 OS=Syntrophus aciditrophicus (strain SB) GN=groL2 PE=3 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 2.428e-83
Identity = 156/269 (57.99%), Postives = 203/269 (75.46%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A K + NGVN LAD V VTLGPKGRNV+++  +GAP +  DGVTVAKEVELED  EN+GA++VR+ A+KT+D+AGDGTTT+ +LAQ +  EG K VAAG+NP+ + RGIEK   A+V+ELK +SK  +D  E+A V  +SA N+  +GN+IAEAM KVG++GV+T+EE K  E  L +VEGMQFDRGY+SPYFVT+ EKM V  E+  +L+ +KKI+  +DL+ +LE   +   P+LIIAEDIE EAL TLVVNK+RG L  AA+K  G
Sbjct:   12 ARKSILNGVNALADAVKVTLGPKGRNVIIDKSFGAPTVTKDGVTVAKEVELEDKFENMGAQMVREVASKTSDVAGDGTTTATILAQAIYREGAKTVAAGSNPMDVKRGIEKAVAAVVTELKNISKPTKDQKEIAQVGTISANNDETIGNIIAEAMGKVGKEGVITVEEAKGLETELEIVEGMQFDRGYLSPYFVTNPEKMEVSLEDALILIYEKKISGMKDLLPILEQIAKMGRPLLIIAEDIEGEALATLVVNKIRGTLHVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NAUPA (60 kDa chaperonin OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=groL PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 3.170e-83
Identity = 159/270 (58.89%), Postives = 208/270 (77.04%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIR-GAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  +L  GV KLAD V VT+GPKGRNV+L+  +GAP I  DGV+VAKE+EL+ PVEN+GA+LV++ A+KT D AGDGTTT+ VLA  +  EG+K + AGANPV + RG++K  +A+++ELK+MSK VE+ E +A VA +SA N+ ++G +IAEAM KVG+ GV+T+EEGKS ++ L VVEGMQFDRGY+SPYFVTD+EKM  E  +  +LL DKKI+N +DL+ +LE  ++ G  P+LIIAEDIE EAL TLVVNKLRG L   A+K  G
Sbjct:   12 ARNELLAGVEKLADAVRVTMGPKGRNVLLQRSFGAPHITKDGVSVAKEIELKHPVENMGAQLVKEVASKTADEAGDGTTTATVLAHAVFKEGLKYITAGANPVAVKRGMDKAVEAIIAELKKMSKTVENKEQIAQVATISANNDKKIGELIAEAMDKVGKDGVITVEEGKSLQDELEVVEGMQFDRGYLSPYFVTDTEKMVAELNDAYILLYDKKISNMKDLLPLLEQMVQAGNKPLLIIAEDIEGEALATLVVNKLRGVLNVCAVKAPG 281          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_SYNSC (60 kDa chaperonin 2 OS=Synechococcus sp. (strain CC9605) GN=groL2 PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 3.170e-83
Identity = 157/269 (58.36%), Postives = 204/269 (75.84%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ L + V VTLGPKGRNVVLE K+GAP+I+NDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++  G++ VAAGAN + + +GI+K S  LVS++K+M+K + DS  +A V  +SAGN+ EVG MIA+AM KVG++GV++LEEGKS E  L V EGM+FD+GYISPYF TD+E+M    +   +LL DKKI   +DL+ VLE   R   P+LIIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALEKGIDILCEAVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLRNVAAGANAITLKKGIDKASDFLVSKIKEMAKPIADSNAIAQVGTISAGNDEEVGKMIADAMDKVGKEGVISLEEGKSMETELEVTEGMRFDKGYISPYFATDTERMEAVLDEPYILLTDKKIGLVQDLVPVLEQIARTGKPLLIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GEOTN (60 kDa chaperonin OS=Geobacillus thermodenitrificans (strain NG80-2) GN=groL PE=3 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 4.141e-83
Identity = 162/269 (60.22%), Postives = 201/269 (74.72%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + +  GV+KLAD V VTLGPKGRNVVLE K+G+P I NDGVT+AKE+ELEDP EN+GAKLV + A+KTND+AGDGTTT+ VLAQ +I EG+K VAAGANP+ I RGIEK     V ELK +SK ++  E +A VAA+SA +  EVG +IAEAM +VG  GV+TLEE K     L VVEGMQFDRGY+SPY +TD+EKM    EN  +L+ DKK++N ++L+ VLE  ++   P+LIIAED+E EAL TLVVNKLRG     A+K  G
Sbjct:   11 ARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISAADE-EVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSNIQELLPVLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPG 278          
The following BLAST results are available for this feature:
BLAST of EY659218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH601_ANAVT2.868e-8459.1160 kDa chaperonin 1 OS=Anabaena variabilis (strain... [more]
CH601_ANASP2.868e-8459.1160 kDa chaperonin 1 OS=Anabaena sp. (strain PCC 71... [more]
CH602_SYNY34.891e-8459.3260 kDa chaperonin 2 OS=Synechocystis sp. (strain P... [more]
CH601_SYNY34.891e-8457.9960 kDa chaperonin 1 OS=Synechocystis sp. (strain P... [more]
CH601_GLOVI4.891e-8459.1160 kDa chaperonin 1 OS=Gloeobacter violaceus GN=gr... [more]
CH601_THEVL1.423e-8358.3660 kDa chaperonin 1 OS=Thermosynechococcus vulcanu... [more]
CH602_SYNAS2.428e-8357.9960 kDa chaperonin 2 OS=Syntrophus aciditrophicus (... [more]
CH60_NAUPA3.170e-8358.8960 kDa chaperonin OS=Nautilia profundicola (strain... [more]
CH602_SYNSC3.170e-8358.3660 kDa chaperonin 2 OS=Synechococcus sp. (strain C... [more]
CH60_GEOTN4.141e-8360.2260 kDa chaperonin OS=Geobacillus thermodenitrifica... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659218 ID=EY659218|Name=EY659218|organism=Citrus sinensis|type=EST|length=881bp
AGAACTTGCATTTCAACAAGNATGGATATGCCATGAAGAAACTTCAAAAT
GGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCCTTGGTCCCAAGGG
CAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCAAAAATTGTGAATG
ATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGACCCGGTTGAGAAC
ATTGGTGCTAAATTAGTGAGACAAGCAGCTGCCAAGACTAATGACTTGGC
TGGTGATGGAACAACAACATCTGTTGTTCTTGCGCAAGGGCTTATAGCTG
AAGGTGTTAAGGTCGTGGCAGCTGGTGCAAATCCTGTTCTTATCACAAGA
GGCATTGAGAAGACATCTAAGGCTCTTGTTTCTGAGCTCAAGCAGATGTC
AAAAGAGGTTGAAGATAGTGAACTTGCCGATGTAGCAGCTGTTAGTGCAG
GGAACAACTATGAAGTTGGGAATATGATTGCAGAAGCCATGAGTAAAGTG
GGACGTAAGGGTGTGGTGACCCTTGAAGAGGGAAAAAGTGCTGAGAATAT
GCTCTATGTTGTTGAGGGAATGCAATTTGATCGTGGTTATATTTCTCCCT
ACTTCGTCACTGATAGTGAGAAAATGGCAGTTGAATATGAGAACTGCAAG
TTGCTTCTTGTGGATAAAAAGATTACCAATGCAAGGGACCTTATCAACGT
TTTGGAAGATGCGATTAGAGGTGCATACCCAATTTTGATTATTGCAGAAG
ATATTGAGCAAGAAGCACTGGGCACTCTTGTCGTGAACAAGCTGAGAGGT
GCATTGGAGAATGCTGCTCTTAAGCTCCTGGGTTTGAGAGCGGCAGAGCA
GTACCTTGAGACATTGCTTTTTGACTGGAGG
back to top