DR405962

Overview
NameDR405962
Unique NameDR405962
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_HUMAN (UDP-glucose 4-epimerase OS=Homo sapiens GN=GALE PE=1 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 1.731e-46
Identity = 102/189 (53.97%), Postives = 129/189 (68.25%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASE------IAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            MA+ +LVTGGAGYIGSHTVL+LL  GY  VV+DN  NA         ++ +V+EL G    ++ F ++D+ D+ AL+ LF K  F AVIHFAGL+AVGESVQKPL Y+  NL GTI LLE+M AHG KNLVFSSSATVYG P+ +P  E  P     NPYG++K FIEE+ RD+ ++D  W   +   F
Sbjct:    1 MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGR---SVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYF 186          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GAL10_SCHPO (Bifunctional protein gal10 OS=Schizosaccharomyces pombe GN=gal10 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.338e-44
Identity = 95/182 (52.20%), Postives = 122/182 (67.03%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYG----WPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            ILVTGGAGYIGSHTV++L+  GYK ++VDNL N+   AVA+V+ +      ++ F KLDLRDK  L  +F   K   VIHFA L+AVGES++ PL Y+DNN+ GTITLL VM  H  K +VFSSSATVYG    +  ++P  E  P +  NPYG+TK  IE I +D+H SD+ W+  I   F
Sbjct:    8 ILVTGGAGYIGSHTVIELINHGYKVIIVDNLCNSCYDAVARVEFIVRK---SIKFFKLDLRDKEGLAQIFDTFKIKGVIHFAALKAVGESMKLPLEYYDNNICGTITLLNVMREHRVKTVVFSSSATVYGDATRFDNMIPIPESCPNDPTNPYGKTKYAIENIIKDLHTSDNTWRGAILRYF 186          

HSP 2 Score: 23.0978 bits (48), Expect = 1.338e-44
Identity = 8/13 (61.54%), Postives = 10/13 (76.92%), Query Frame = 1
Query:  691 LLRYFNPVXXXPS 729
            +LRYFNP+   PS
Sbjct:  182 ILRYFNPIGAHPS 194          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GAL10_YEAST (Bifunctional protein GAL10 OS=Saccharomyces cerevisiae GN=GAL10 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 2.463e-43
Identity = 92/189 (48.68%), Postives = 127/189 (67.20%), Query Frame = 3
Query:  153 DSMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYG----WPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSE-WKDHIAEIF 704
            +S +K +LVTGGAGYIGSHTV++L+  GY  VV DNL N++  +VA+++ L  +   ++ F+++DL D+  LE +F + K  +VIHFAGL+AVGES Q PL Y+ NN++GT+ LLE+M  +     VFSSSATVYG    +P ++P  EE PL   NPYG TK  IE I  D++ SD + WK  I   F
Sbjct:    8 ESTSKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTKH---HIPFYEVDLCDRKGLEKVFKEYKIDSVIHFAGLKAVGESTQIPLRYYHNNILGTVVLLELMQQYNVSKFVFSSSATVYGDATRFPNMIPIPEECPLGPTNPYGHTKYAIENILNDLYNSDKKSWKFAILRYF 193          

HSP 2 Score: 24.6386 bits (52), Expect = 2.463e-43
Identity = 9/16 (56.25%), Postives = 11/16 (68.75%), Query Frame = 1
Query:  682 KIILLRYFNPVXXXPS 729
            K  +LRYFNP+   PS
Sbjct:  186 KFAILRYFNPIGAHPS 201          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GAL10_KLULA (Bifunctional protein GAL10 OS=Kluyveromyces lactis GN=GAL10 PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 1.206e-42
Identity = 94/184 (51.09%), Postives = 121/184 (65.76%), Query Frame = 3
Query:  165 KNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYG----WPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            K  LVTGGAGYIGSHTV++L   GYK +VVDNL N+S  +VA+++ L G +   + F K+DL +   L  LF   K  +V+HFAGL+AVGES Q PL Y+ NN++GTI LLE M +H  K LVFSSSATVYG    +  ++P  E  P    NPYG+TKL IE++ RD+H SD  +   I   F
Sbjct:    5 KYCLVTGGAGYIGSHTVVELCEAGYKCIVVDNLSNSSYESVARMELLTGQE---IKFAKIDLCELEPLNKLFDDYKIDSVLHFAGLKAVGESTQIPLTYYFNNIVGTINLLECMKSHDVKKLVFSSSATVYGDATRFENMIPIPETCPTGPTNPYGKTKLTIEDMMRDLHFSDKSFSFAILRYF 185          

HSP 2 Score: 23.0978 bits (48), Expect = 1.206e-42
Identity = 8/13 (61.54%), Postives = 10/13 (76.92%), Query Frame = 1
Query:  691 LLRYFNPVXXXPS 729
            +LRYFNP+   PS
Sbjct:  181 ILRYFNPIGAHPS 193          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_RAT (UDP-glucose 4-epimerase OS=Rattus norvegicus GN=Gale PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.378e-42
Identity = 98/190 (51.58%), Postives = 127/190 (66.84%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASE------IAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLE--AMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            M + +LVTGGAGYIGSHTVL+LL  GY  VV+DN  N+         ++ +V+EL G    ++ F ++D+ D+AAL+ LF K  F AVIHFAGL+AVGESVQKPL Y+  NL GTI LLE+M A G K+LVFSSSATVYG P  VP +   P       PYG++K FIEE+ +D+ R+D+ W   +   F
Sbjct:    1 MEEKVLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNSIRGEDSMPESLRRVQELTGR---SVEFEEMDILDQAALQHLFKKHNFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAMGVKSLVFSSSATVYGKP--VPASGRGPPHRGCTKPYGKSKFFIEEMIQDLCRADTAWNAVLLRYF 185          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_YERPE (UDP-glucose 4-epimerase OS=Yersinia pestis GN=galE PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.567e-42
Identity = 87/179 (48.60%), Postives = 119/179 (66.48%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            +LVTGG+GYIGSHT +QL+  GYK V++DNL N+    +A++  L G   +    +  D+RD+  L+++FA     AVIHFAGL+AVGESV +PL Y++NN+ GT+ LLE M A   KNL+FSSSATVYG    +P  E FP     +PYGR+KL +E+I +DV  +D +W   I   F
Sbjct:    3 VLVTGGSGYIGSHTCVQLIEAGYKPVILDNLCNSKSSVLARIHSLTGYTPE---LYAGDIRDRTLLDSIFAAHPIHAVIHFAGLKAVGESVNRPLEYYNNNVFGTLVLLEAMRAAQVKNLIFSSSATVYGDQPQIPYVESFPTGSPSSPYGRSKLMVEQILQDVQLADPQWNMTILRYF 178          

HSP 2 Score: 23.483 bits (49), Expect = 4.567e-42
Identity = 9/13 (69.23%), Postives = 10/13 (76.92%), Query Frame = 1
Query:  691 LLRYFNPVXXXPS 729
            +LRYFNPV   PS
Sbjct:  174 ILRYFNPVGAHPS 186          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GAL10_PACTA (Bifunctional protein GAL10 OS=Pachysolen tannophilus GN=GAL10 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 4.903e-41
Identity = 90/182 (49.45%), Postives = 117/182 (64.29%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYG----WPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            ILVTGGAGYIGSHTV++L+  GY  VVVDNL N+S   + +++ L   Q   + F K+DL D  AL+ +F      AV+HFA L+AVGES + PL Y+ NN+ G I+LL+VM  +  KN+VFSSSATVYG    +  ++P  E  P    NPYG TK+ IE I RDV+ +D  WK  I   F
Sbjct:    4 ILVTGGAGYIGSHTVVELVNNGYNVVVVDNLVNSSYDVIVRIEVLTRKQ---IPFFKIDLNDHDALDQVFKLYPIQAVLHFAALKAVGESTKFPLNYYSNNVGGAISLLKVMEENNVKNIVFSSSATVYGDATRFENMIPIPEHCPTGPTNPYGETKITIENIIRDVYANDKSWKCAILRYF 182          

HSP 2 Score: 24.2534 bits (51), Expect = 4.903e-41
Identity = 9/16 (56.25%), Postives = 11/16 (68.75%), Query Frame = 1
Query:  682 KIILLRYFNPVXXXPS 729
            K  +LRYFNP+   PS
Sbjct:  175 KCAILRYFNPIGAHPS 190          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_NEIMA (UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup A GN=galE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 6.442e-41
Identity = 83/173 (47.98%), Postives = 121/173 (69.94%), Query Frame = 3
Query:  165 KNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEW 680
            KNILVTGG G+IGSHTV+ LL  G++ V++DNL N+S   + ++K + G +   + F++ D+RD+  L  +FA+ +  +VIHFAGL+AVGESV +P+ Y+DNN+ G++ L E MA  G  ++VFSSSATVYG P  VP TE+ PL +  +PYG +K  +E I  D+ ++D  W
Sbjct:    2 KNILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILPRLKTITGQE---IPFYQGDIRDREILRRIFAENRIDSVIHFAGLKAVGESVAEPMKYYDNNVSGSLVLAEEMARAGVFSIVFSSSATVYGDPGKVPYTEDMPLGDTTSPYGTSKSMVERILTDIQKADPRW 171          

HSP 2 Score: 22.7126 bits (47), Expect = 6.442e-41
Identity = 8/10 (80.00%), Postives = 10/10 (100.00%), Query Frame = 1
Query:  685 IILLRYFNPV 714
            +ILLRYFNP+
Sbjct:  173 MILLRYFNPI 182          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: YGRE_SCHPO (Uncharacterized protein C365.14c OS=Schizosaccharomyces pombe GN=SPBC365.14c PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.087e-40
Identity = 89/166 (53.61%), Postives = 113/166 (68.07%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPK----VVPCTEEFPLEAMNPYGRTKLFIEEICRD 656
            +LVTGGAGYIGSHT + LL  GY  V+VDNL N+   AV ++++L G +   + FH++DL D+ AL+ +FA     AVIHFAGL+AVGESVQ PL Y+ NN+ GTI L+E M  +  ++ VFSSSATVYG P      +P  E  P E  +PYGRTKLFIE I  D
Sbjct:    9 VLVTGGAGYIGSHTCVVLLEKGYDVVIVDNLCNSRVEAVHRIEKLTGKK---VIFHQVDLLDEPALDKVFANQNISAVIHFAGLKAVGESVQVPLSYYKNNISGTINLIECMKKYNVRDFVFSSSATVYGDPTRPGGTIPIPESCPREGTSPYGRTKLFIENIIED 171          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_HAEIN (UDP-glucose 4-epimerase OS=Haemophilus influenzae GN=galE PE=3 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 5.393e-40
Identity = 86/179 (48.04%), Postives = 124/179 (69.27%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            ILVTGGAGYIGSHTV++LL  G + VV+DNL N+S  ++ +VK++ G +     F++ D+ D+A L+ +FA+ +  +VIHFAGL+AVGESVQKP  Y+ NN+ GT+ L++ M   G  N VFSSSATVYG PK++P TE+  +    NPYG +K  +E+I RD  +++ ++   I   F
Sbjct:    3 ILVTGGAGYIGSHTVVELLNVGKEVVVLDNLCNSSPKSLERVKQITGKEAK---FYEGDILDRALLQKIFAENEINSVIHFAGLKAVGESVQKPTEYYMNNVAGTLVLIQEMKKAGVWNFVFSSSATVYGDPKIIPITEDCEVGGTTNPYGTSKYMVEQILRDTAKAEPKFSMTILRYF 178          
The following BLAST results are available for this feature:
BLAST of DR405962 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
GALE_HUMAN1.731e-4653.97UDP-glucose 4-epimerase OS=Homo sapiens GN=GALE PE... [more]
GAL10_SCHPO1.338e-4452.20Bifunctional protein gal10 OS=Schizosaccharomyces ... [more]
GAL10_YEAST2.463e-4348.68Bifunctional protein GAL10 OS=Saccharomyces cerevi... [more]
GAL10_KLULA1.206e-4251.09Bifunctional protein GAL10 OS=Kluyveromyces lactis... [more]
GALE_RAT3.378e-4251.58UDP-glucose 4-epimerase OS=Rattus norvegicus GN=Ga... [more]
GALE_YERPE4.567e-4248.60UDP-glucose 4-epimerase OS=Yersinia pestis GN=galE... [more]
GAL10_PACTA4.903e-4149.45Bifunctional protein GAL10 OS=Pachysolen tannophil... [more]
GALE_NEIMA6.442e-4147.98UDP-glucose 4-epimerase OS=Neisseria meningitidis ... [more]
YGRE_SCHPO1.087e-4053.61Uncharacterized protein C365.14c OS=Schizosaccharo... [more]
GALE_HAEIN5.393e-4048.04UDP-glucose 4-epimerase OS=Haemophilus influenzae ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E24 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E24 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405962 ID=DR405962|Name=DR405962|organism=Citrus sinensis|type=EST|length=729bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAATGGAAAGATCATATTGCTGAGAT
ATTTCAATCCTGTTGNNNNNNATCCAAGT
back to top