DR405962

Overview
NameDR405962
Unique NameDR405962
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: ARAE1_ARATH (UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.195e-33
Identity = 74/167 (44.31%), Postives = 101/167 (60.48%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRS 668
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  ++EL    G  + F   DL D  A+  +F +  F AV+HFA +  VGES Q PL Y+ N    T+ +LE MAAHG K L++SS+   YG P ++P TEE P   +NPYG+ K   E+I  D  ++
Sbjct:   72 HVLVTGGAGYIGSHAALRLLKESYRVTIVDNLSRGNLAAVRILQELFPEPG-RLQFIYADLGDAKAVNKIFTENAFDAVMHFAAVAYVGESTQFPLKYYHNITSNTLVVLETMAAHGVKTLIYSSTCATYGEPDIMPITEETPQVPINPYGKAKKMAEDIILDFSKN 237          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_PASHA (UDP-glucose 4-epimerase OS=Pasteurella haemolytica GN=galE PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.889e-33
Identity = 73/163 (44.79%), Postives = 109/163 (66.87%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRD 656
            ILVTGGAGYIGSHT+++LL    + VV+DNL N+SE+++ +VK++ G    ++ F++ D+ D+  L  +FA+ +  +VIHFAGL+AVGE+ +   +   NN+ G+I L+E M       +VFSSSATVYG P+++P  E  P+    NPYG +K  +E I  D
Sbjct:    3 ILVTGGAGYIGSHTLVELLNENREIVVLDNLSNSSEVSLERVKQITGK---SVKFYQGDILDRDILRKIFAENQIESVIHFAGLKAVGETSENRYVTIKNNVTGSIVLVEEMLKANVNTIVFSSSATVYGDPQIIPIVESCPVGGTTNPYGTSKYMVERILED 162          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: ARAE2_ARATH (Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsis thaliana GN=At2g34850 PE=2 SV=3)

HSP 1 Score: 139.428 bits (350), Expect = 1.858e-32
Identity = 73/167 (43.71%), Postives = 102/167 (61.08%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRS 668
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  +++L    G  + F   DL D  A+  +F++  F AV+HFA +  VGES Q PL Y+ N    T+ +LE MAAHG K L++SS+   YG P+ +P TEE P   +NPYG+ K   E+I  D  ++
Sbjct:   71 HVLVTGGAGYIGSHAALRLLKDSYRVTIVDNLSRGNLGAVKILQQLFPEPG-KLQFIYADLGDANAVNKIFSENAFDAVMHFAAVAYVGESTQFPLKYYHNITSNTLVVLETMAAHGVKTLIYSSTCATYGEPEKMPITEETPQVPINPYGKAKKMAEDIILDFSKN 236          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_BACHD (UDP-glucose 4-epimerase OS=Bacillus halodurans GN=galE PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.504e-31
Identity = 75/159 (47.17%), Postives = 96/159 (60.38%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEI 647
            ILVTGGAGYIGSHTVL LL  G + +V+DNL      A++ V           TF+  D+RD   L+ +F       VIHFA    VGESV++P+ Y++NN+IGT TLL+ M  H  K +VFSS+A  YG P  +P  E  P    NPYG TKL IE++
Sbjct:    3 ILVTGGAGYIGSHTVLFLLEQGEQVIVLDNLQKGHAGALSDV-----------TFYHGDIRDDQLLDTIFTTHSIDTVIHFAANSLVGESVKQPIEYYENNVIGTHTLLKKMLEHDVKKIVFSSTAATYGEPVQIPIQESDPTIPTNPYGETKLAIEKM 150          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: ARAE2_ORYSJ (Probable UDP-arabinose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UEL-2 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.805e-31
Identity = 70/163 (42.94%), Postives = 97/163 (59.51%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRD 656
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  ++ L    G  + F   DL D  A+  +F++  F AV+HFA +  VGES  +PL Y+ N    T+T+LE MAA+  K L++SS+   YG P  +P TE  P   +NPYG+ K   E+I  D
Sbjct:   51 HVLVTGGAGYIGSHATLRLLRDNYRVTIVDNLSRGNMGAVRVLQRLFPEPG-RLQFIYADLGDAKAVNKIFSENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLTVLEAMAAYNVKTLIYSSTCATYGEPDTMPITEATPQNPINPYGKAKKMAEDIILD 212          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: ARAE1_ORYSJ (Probable UDP-arabinose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UEL-1 PE=2 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 1.331e-30
Identity = 69/167 (41.32%), Postives = 99/167 (59.28%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRS 668
            ++LVTGGAGYIGSH  L+LL   ++  +VDNL   +  A+  ++ L    G  + F   DL D  A+  +FA+  F AV+HFA +  VGES  +PL Y+ N    T+ +LE MAAH  + L++SS+   YG P+ +P TE  P   +NPYG+ K   E+I  D  +S
Sbjct:   74 HVLVTGGAGYIGSHAALRLLKDSFRVTIVDNLSRGNMGAIKVLQNLFSEPG-RLQFIYADLGDPKAVNRIFAENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLVVLEAMAAHNVRTLIYSSTCATYGEPEKMPITEGTPQFPINPYGKAKKMAEDIILDFSKS 239          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: EXOB_RHIME (UDP-glucose 4-epimerase OS=Rhizobium meliloti GN=exoB PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.966e-30
Identity = 74/163 (45.40%), Postives = 92/163 (56.44%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRD 656
            NILV GGAGYIGSHT LQL   GY+ VV DNL N  E  V                 K D+RD+  L+ + A+ K  A++HFA +  VGESV+ P  ++DNN+IGT+TLL    A G    VFSS+   YG P  VP  E      +NPYGRTK   E+  +D
Sbjct:    5 NILVVGGAGYIGSHTCLQLAAKGYQPVVYDNLSNGHEEFVKWG-----------VLEKGDIRDRQRLDEVLARHKPRAILHFAAMIEVGESVKDPAAFYDNNVIGTLTLLSAALAAGIDAFVFSSTCATYGLPDSVPMDESHKQAPINPYGRTKWICEQALKD 156          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: ARAE4_ARATH (Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsis thaliana GN=At5g44480 PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.966e-30
Identity = 69/167 (41.32%), Postives = 100/167 (59.88%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRS 668
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  +++L    G  + F   DL D  A+E +F++  F AV+HFA +  VGES   PL Y+ N    T+ +LE MA H  K L++SS+   YG P+ +P TE+ P   +NPYG+ K   E++  D  ++
Sbjct:   96 HVLVTGGAGYIGSHAALRLLRDSYRVTIVDNLSRGNLGAVKTLQQLFPQTG-RLQFIYADLGDPLAVEKIFSENAFDAVMHFAAVAYVGESTLYPLKYYHNITSNTLGVLEAMARHKVKKLIYSSTCATYGEPEKMPITEDTPQVPINPYGKAKKMAEDMILDFSKN 261          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_KLEPN (UDP-glucose 4-epimerase (Fragment) OS=Klebsiella pneumoniae GN=galE PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.630e-30
Identity = 68/139 (48.92%), Postives = 93/139 (66.91%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTE 587
            +LVTGG+GYIGSHT +QLL  G++ V++DNL N+    +  ++ L G +    TF + D+R++A +  +       AVIHFAGL+AVGESV KPL Y+DNN+ GT+ L+  M A G KN +FSSSATVYG    +P  E
Sbjct:    3 VLVTGGSGYIGSHTCVQLLQRGHEVVILDNLCNSKRRILPVIERLGGKEA---TFIEGDIRNEARMTEILHDHAIEAVIHFAGLKAVGESVAKPLEYYDNNVTGTLKLVSAMRAAGVKNFIFSSSATVYGDQPKIPYVE 138          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: ARAE3_ORYSJ (Probable UDP-arabinose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UEL-3 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.630e-30
Identity = 69/163 (42.33%), Postives = 97/163 (59.51%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRD 656
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  ++EL    G  + F   DL D+  +  +FA+  F AV+HFA +  VGES  +PL Y+ N    T+ +LE MA+HG K L++SS+   YG P+ +P  E      +NPYG+ K   E+I  D
Sbjct:   65 HVLVTGGAGYIGSHASLRLLKDNYRVTIVDNLSRGNMGAVKVLQELFPQPG-RLQFIYADLGDQKTVNKIFAENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLLILEAMASHGVKTLIYSSTCATYGEPEKMPIVETTRQLPINPYGKAKKMAEDIILD 226          
The following BLAST results are available for this feature:
BLAST of DR405962 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
ARAE1_ARATH2.195e-3344.31UDP-arabinose 4-epimerase 1 OS=Arabidopsis thalian... [more]
GALE_PASHA4.889e-3344.79UDP-glucose 4-epimerase OS=Pasteurella haemolytica... [more]
ARAE2_ARATH1.858e-3243.71Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsi... [more]
GALE_BACHD3.504e-3147.17UDP-glucose 4-epimerase OS=Bacillus halodurans GN=... [more]
ARAE2_ORYSJ7.805e-3142.94Probable UDP-arabinose 4-epimerase 2 OS=Oryza sati... [more]
ARAE1_ORYSJ1.331e-3041.32Probable UDP-arabinose 4-epimerase 1 OS=Oryza sati... [more]
EXOB_RHIME2.966e-3045.40UDP-glucose 4-epimerase OS=Rhizobium meliloti GN=e... [more]
ARAE4_ARATH2.966e-3041.32Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsi... [more]
GALE_KLEPN8.630e-3048.92UDP-glucose 4-epimerase (Fragment) OS=Klebsiella p... [more]
ARAE3_ORYSJ8.630e-3042.33Probable UDP-arabinose 4-epimerase 3 OS=Oryza sati... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E24 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E24 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405962 ID=DR405962|Name=DR405962|organism=Citrus sinensis|type=EST|length=729bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAATGGAAAGATCATATTGCTGAGAT
ATTTCAATCCTGTTGNNNNNNATCCAAGT
back to top