DR405962

Overview
NameDR405962
Unique NameDR405962
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GAE1_ARATH (UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thaliana GN=GAE1 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.084e-11
Identity = 52/163 (31.90%), Postives = 86/163 (52.76%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKE-LAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEV-MAAHGCKNLVFSSSATVYGWPKVVPCTE-EFPLEAMNPYGRTKLFIEEI 647
            ++LVTG  G++GSH  L L   G   V +DN +N  + ++ + +  L  ++G  +   + DL D   L  LF    F  V+H A    V  +++ P  Y  +N+ G + LLE+  AA+    +V++SS++VYG  + VP +E +   +  + Y  TK   EEI
Sbjct:   89 SVLVTGATGFVGSHVSLALRKRGDGVVGLDNFNNYYDPSLKRARRSLLSSRGIFVV--EGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVRYALENPQSYVHSNIAGLVNLLEICKAANPQPAIVWASSSSVYGLNEKVPFSESDRTDQPASLYAATKKAGEEI 249          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: TGDS_HUMAN (dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.260e-11
Identity = 49/160 (30.63%), Postives = 72/160 (45.00%), Query Frame = 3
Query:  162 AKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIE 641
            AK +LVTGGAG+I SH ++ L+   Y   ++ NLD     A  K  E   N+  N  F + D+ D   ++ LF   K   V+HFA    V  S  +   +   N+ GT  L+        +  ++ S+  VYG        E  P +  NPY  +K   E
Sbjct:   17 AKRVLVTGGAGFIASHMIVSLV-EDYPNYMIINLDKLDYCASLKNLETISNK-QNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAHEARVEKFIYVSTDEVYGGSLDKEFDESSPKQPTNPYASSKAAAE 174          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: LPSL_RHIME (UDP-glucuronate 5'-epimerase OS=Rhizobium meliloti GN=lspL PE=3 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 6.869e-11
Identity = 44/157 (28.03%), Postives = 78/157 (49.68%), Query Frame = 3
Query:  174 LVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTE-EFPLEAMNPYGRTKLFIE 641
            L+TG AG+IG H   +L+  G+  V  D +    ++ + + +     + +        L D+AAL+      +   +IH A    V  S++ P  Y D NL+G+  +LE+  A   K+L+ +S++++YG  + +P  E +   E M  Y  TK  +E
Sbjct:    4 LITGTAGFIGFHVAKRLIDEGHFVVGFDGMTPYYDVTLKERRHAILQRSNGFKAVTAMLEDRAALDRAAELAEPEVIIHLAAQAGVRYSLENPKAYVDANLVGSWNMLELAKAIAPKHLMLASTSSIYGANEKIPFAEADRADEPMTLYAATKKSME 160          
The following BLAST results are available for this feature:
BLAST of DR405962 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
GAE1_ARATH3.084e-1131.90UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thali... [more]
TGDS_HUMAN5.260e-1130.63dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=... [more]
LPSL_RHIME6.869e-1128.03UDP-glucuronate 5'-epimerase OS=Rhizobium meliloti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E24 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E24 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405962 ID=DR405962|Name=DR405962|organism=Citrus sinensis|type=EST|length=729bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAATGGAAAGATCATATTGCTGAGAT
ATTTCAATCCTGTTGNNNNNNATCCAAGT
back to top