DR403410

Overview
NameDR403410
Unique NameDR403410
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length308
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13130 contig Csv1_Contig13130:1096..1403. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: CATH_MOUSE (Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.213e-14
Identity = 27/44 (61.36%), Postives = 37/44 (84.09%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 135
            G ++G+ YW++KNSWG  WG++GYF +E GKNMCG+A CASYP+
Sbjct:  287 GEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPI 330          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: CATL1_CHICK (Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL1 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.465e-11
Identity = 29/46 (63.04%), Postives = 32/46 (69.57%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMG-KNMCGIATCASYPVV 138
            G E G  YW++KNSWGE WGD GY  M    KN CGIAT ASYP+V
Sbjct:  173 GFEGGKKYWIVKNSWGEKWGDKGYIYMAKDRKNHCGIATAASYPLV 218          
The following BLAST results are available for this feature:
BLAST of DR403410 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
CATH_MOUSE7.213e-1461.36Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1[more]
CATL1_CHICK7.465e-1163.04Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244O22 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244O22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403410 ID=DR403410|Name=DR403410|organism=Citrus sinensis|type=EST|length=308bp
GGGGGAGTTGAAGATGGTGTTCCATATTGGCTGATTAAGAACTCTTGGGG
AGAGAACTGGGGCGATCATGGCTACTTTAAGATGGAGATGGGGAAGAACA
TGTGTGGTATTGCAACTTGTGCATCATACCCAGTTGTGGCTTAGTCTGCT
CCTGAAGAAATAGTTGGATCTGGCTATCAGCAAGTCATTTGCTCATAAAA
CTTATATTATTTCACTCAAGAATGATAGCAGAATGGTTGGCTTTATGTAC
GAAATAAATTCGGAGATTAATGTCCATACGAAAAAAAAAAAAAAAAAAAA
AAAAAAAA
back to top