DN134859

Overview
NameDN134859
Unique NameDN134859
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length413
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6283 contig Csv1_Contig6283:895..1308. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_LEPTE (Photosystem II reaction center protein I OS=Leptosira terrestris GN=psbI PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.396e-11
Identity = 30/34 (88.24%), Postives = 32/34 (94.12%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGR 151
            MLTLK+FVYTVV FFVSLF+FGFLSNDPGRNP R
Sbjct:    1 MLTLKIFVYTVVTFFVSLFVFGFLSNDPGRNPSR 34          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_PSEAK (Photosystem II reaction center protein I OS=Pseudendoclonium akinetum GN=psbI PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.792e-11
Identity = 30/34 (88.24%), Postives = 32/34 (94.12%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGR 151
            MLTLK+FVYTVV FFVSLFIFGFLSNDPGRNP +
Sbjct:    1 MLTLKIFVYTVVTFFVSLFIFGFLSNDPGRNPNQ 34          
The following BLAST results are available for this feature:
BLAST of DN134859 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 112
Match NameE-valueIdentityDescription
PSBI_LEPTE4.396e-1188.24Photosystem II reaction center protein I OS=Leptos... [more]
PSBI_PSEAK9.792e-1188.24Photosystem II reaction center protein I OS=Pseude... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca02d06 Developing fruit albedo at 80 DAFB in Vulnus5 vector Citrus sinensis cDNA clone wca02d06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN134859 ID=DN134859|Name=DN134859|organism=Citrus sinensis|type=EST|length=413bp
ATCTATTCTCTTTTTCCTTTCCCCAAAAACCTGATTTGGAGATTGTGTAA
TGCTTACTCTCAAACTCTTTGTTTACACCGTAGTGATATTCTTTGTTTCG
CTCTTCATCTTCGGATTCCTGTCTAATGATCCAGGGCGTAATCCCGGACG
CGAAGAATAAAAAAGGAAGGAGTTGCTTACTTTATTCGTATAAACGTTCT
TAGGATTTTTTGATTCCCAGTTACTATTAAAAATAAAGTAAAAGTGTTCG
CTAAAGTTAAATTTGAAAAATACCAAGCCATCGCCCGAAACGGAAAGAGA
GGGATTCGAACCCTCGGTACGAAGAACTCGTACACCGGATTACCAATCCG
ACGCTTTAATCCACTCAGCCATCTCTCCTAATTGAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA
back to top