DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP2_DICDI (Cysteine proteinase 2 OS=Dictyostelium discoideum GN=cprB PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.130e-11
Identity = 45/159 (28.30%), Postives = 64/159 (40.25%), Query Frame = 1
Query:   55 SSYPYIGKRGK-CQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKG------------------------------FSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            SSYPY  + G  C F+   I   +  + NI         +   HGP+++ ++A     Q Y  G+     C    L+HGVL+VGYG +G                                 +R     YWI+KNSWG  WG  GY  + + R   CG+
Sbjct:  209 SSYPYTAETGSTCLFNKSDIGATIKGYVNITAGSEISLENGAQHGPVSVAIDASHNSFQLYTSGIYYEPKCSPTELDHGVLVVGYGVQGKDDEGPVLNRKQTIVIHKNEDNKVESSDDSSDSVRPKANNYWIVKNSWGTSWGIKGYILMSKDRKNNCGI 367          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATC_MACFA (Dipeptidyl-peptidase 1 OS=Macaca fascicularis GN=CTSC PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.782e-11
Identity = 42/141 (29.79%), Postives = 62/141 (43.97%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTNIP-----VDENQIAAHLVHHGPLAIGL----------NAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            +PY G    C+   +      + +  +       +E  +   LV+HGPLA+            N I+  T +     P     +  NH VLLVGYG    S        YWI+KNSWG  WG+ GY+R+ RG   C + ++
Sbjct:  322 FPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVYHGPLAVAFEVYDDFLHYQNGIYHHTGLRDPFNPF----ELTNHAVLLVGYGTDSAS-----GMDYWIVKNSWGTSWGEDGYFRIRRGTDECAIESI 453          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATC_SCHMA (Cathepsin C OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.633e-11
Identity = 42/140 (30.00%), Postives = 63/140 (45.00%), Query Frame = 1
Query:   64 PYIGK-RGKCQFDSEKIAVRVANFTNI-----PVDENQIAAHLVHHGPLAIGLNAIF-MQTYIGGVSCPLICGK--------KWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            PY G+  GKC            +++ I       +E  +   L+ +GP  +G       Q Y  G+                +  NH VLLVGYG       +L  +PYW +KNSWG +WG+ GY+R+ RG   CG+ ++
Sbjct:  312 PYTGEDTGKCTVSKNCTRYYTTDYSYIGGYYGATNEKLMQLELISNGPFPVGFEVYEDFQFYKEGIYHHTTVQTDHYNFNPFELTNHAVLLVGYGVD-----KLSGEPYWKVKNSWGVEWGEQGYFRILRGTDECGVESL 446          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP1_ORYSJ (Cysteine protease 1 OS=Oryza sativa subsp. japonica GN=CP1 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 4.745e-11
Identity = 43/133 (32.33%), Postives = 63/133 (47.37%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSE-KIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG----RGMCGMNTM 438
            YPY    GKC      +  V +  F ++P ++       V H P+++ ++A     Q Y  GV     CG   L+HGV+ VGYG    +        YW ++NSWG  WG++GY R+ R      G CG+  M
Sbjct:  244 YPYTAMDGKCNLAKRSRKVVSIDGFEDVPENDELSLQKAVAHQPVSVAIDAGGREFQLYDSGVFTGR-CGTN-LDHGVVAVGYGTDAAT-----GAAYWTVRNSWGPDWGENGYIRMERNVTARTGKCGIAMM 369          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATC_HUMAN (Dipeptidyl-peptidase 1 OS=Homo sapiens GN=CTSC PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.745e-11
Identity = 41/141 (29.08%), Postives = 62/141 (43.97%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTNIP-----VDENQIAAHLVHHGPLAIGLNA----------IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            +PY G    C+   +      + +  +       +E  +   LVHHGP+A+              I+  T +     P     +  NH VLLVGYG    S        YWI+KNSWG  WG++GY+R+ RG   C + ++
Sbjct:  322 FPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPF----ELTNHAVLLVGYGTDSAS-----GMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESI 453          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: P34_SOYBN (P34 probable thiol protease OS=Glycine max PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 45/136 (33.09%), Postives = 65/136 (47.79%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANF-TNIPVDEN------QIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKW-LNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR----GMCGMN 432
            YPY  K G+C+ +  +  V +  + T I  DE+      Q     +   P+++ ++A     Y GG+     C   + +NH VLLVGYG+            YWI KNSWG  WG+ GY  + R      G+CGMN
Sbjct:  221 YPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYTGGIYDGENCTSPYGINHFVLLVGYGSAD-------GVDYWIAKNSWGFDWGEDGYIWIQRNTGNLLGVCGMN 349          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CPR1_ARATH (Probable cysteine proteinase At3g19400 OS=Arabidopsis thaliana GN=At3g19400 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 46/135 (34.07%), Postives = 64/135 (47.41%), Query Frame = 1
Query:   61 YPY-IGKRGKCQFDSEKIA--VRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFM--QTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG----RGMCGMNTM 438
            YPY     G C  D       V +  + ++P D+ +     V H P+++ + A     Q Y  GV     CG   L+HGV++VGYG+          + YWII+NSWG  WGD GY +L R      G CG+  M
Sbjct:  218 YPYNANDLGLCNADKNNNTRVVTIDGYEDVPRDDEKSLKKAVAHQPVSVAIEASSQAFQLYKSGVMTGT-CGIS-LDHGVVVVGYGSTS-------GEDYWIIRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMM 343          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CPGP2_ZINOF (Zingipain-2 OS=Zingiber officinale PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 41/133 (30.83%), Postives = 64/133 (48.12%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGV---SCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG----RGMCGM 429
            +YPY G+ G C        V + ++ N+P    Q     V + P+++ ++A     Q Y  G+   SC +       NH + +VGYG +        ++ +WI+KNSWGK WG+ GY R  R      G CG+
Sbjct:   88 TYPYRGQDGICNSTVNAPVVSIDSYENVPSHNEQSLQKAVANQPVSVTMDAAGRDFQLYRSGIFTGSCNISA-----NHALTVVGYGTEN-------DKDFWIVKNSWGKNWGESGYIRAERNIENPDGKCGI 208          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATC_PONAB (Dipeptidyl-peptidase 1 OS=Pongo abelii GN=CTSC PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.094e-11
Identity = 41/141 (29.08%), Postives = 61/141 (43.26%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTNIP-----VDENQIAAHLVHHGPLAIGLNA----------IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            +PY G    C+   +      + +  +       +E  +   LVHHGP+A+              I+  T +     P     +  NH VLLVGYG    S        YWI+KNSWG  WG+ GY+R+ RG   C + ++
Sbjct:  322 FPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPF----ELTNHAVLLVGYGTDSAS-----GMDYWIVKNSWGTGWGEDGYFRIRRGTDECAIESI 453          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CYSP2_DICDI2.130e-1128.30Cysteine proteinase 2 OS=Dictyostelium discoideum ... [more]
CATC_MACFA2.782e-1129.79Dipeptidyl-peptidase 1 OS=Macaca fascicularis GN=C... [more]
CATC_SCHMA3.633e-1130.00Cathepsin C OS=Schistosoma mansoni PE=2 SV=1[more]
CYSP1_ORYSJ4.745e-1132.33Cysteine protease 1 OS=Oryza sativa subsp. japonic... [more]
CATC_HUMAN4.745e-1129.08Dipeptidyl-peptidase 1 OS=Homo sapiens GN=CTSC PE=... [more]
P34_SOYBN6.198e-1133.09P34 probable thiol protease OS=Glycine max PE=1 SV... [more]
CPR1_ARATH6.198e-1134.07Probable cysteine proteinase At3g19400 OS=Arabidop... [more]
CPGP2_ZINOF6.198e-1130.83Zingipain-2 OS=Zingiber officinale PE=1 SV=1[more]
CATC_PONAB8.094e-1129.08Dipeptidyl-peptidase 1 OS=Pongo abelii GN=CTSC PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top